DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7579 and Galnt12

Sequence 1:NP_648799.1 Gene:CG7579 FlyBaseID:FBgn0036528 Length:498 Species:Drosophila melanogaster
Sequence 2:XP_232988.5 Gene:Galnt12 RGDID:1562001 Length:579 Species:Rattus norvegicus

Alignment Length:545 Identity:157/546 (29%)
Similarity:251/546 (46%) Gaps:116/546 (21%)


  Fly     5 DLVDAQLQNE----------KYQYNAWLSERIPLKRTLEDYRDPQCLKINYSSEKTVTVSIVIAI 59
            :.|..|||.|          ::|.|.:||:||.|.|.|.:..:|.|.::.|..:.....|:|||.
  Rat    75 EAVRLQLQGEELRLQEESVQRHQINIYLSDRISLHRRLPERWNPLCREVKYDYDNLPKTSVVIAF 139

  Fly    60 QQEHPHTLLRGIYSVITQTSPYLLKEIVLVHDGHPDLDLIRHIHHKLPIVIQLE-------MESS 117
            ..|...||||.:|||: :|||.:|.|.|::.|.:.|.:     |.|.|:..:|.       :.:|
  Rat   140 YNEAWSTLLRTVYSVL-ETSPDILLEEVILVDDYSDRE-----HLKEPLANELSQLPKVRLIRAS 198

  Fly   118 K--GIIHARLTGAGVATGDILVFLNGHMEVTRGWLPPLLEPILLNNQTVTEPIVDAISRESFAY- 179
            |  |::.|||.||..|.|::|.||:.|.|...|||.|||:.|......|..|::|.|...:|.| 
  Rat   199 KREGLVRARLLGASAARGEVLTFLDCHCECHEGWLEPLLQRIHEKESAVVCPVIDVIDWNTFEYL 263

  Fly   180 RKLVEPEQLAFDWQLDHIFLPLDQHSWNSLPK--------PYP---SSQLEGRVFAIDRKWFWHL 233
            ....||:...|||:|  :|      :|:.:|:        |..   |..:.|.:||:.:::|.:|
  Rat   264 GNSGEPQIGGFDWRL--VF------TWHVVPQRERKLMRSPIDVIRSPTMAGGLFAVSKRYFEYL 320

  Fly   234 GGWDEGLRDYGGDALELSLKVWQCGGLILAVPCSRVGIIYKRDELEAQMAP-NRNPSLQVQKNFK 297
            |.:|.|:..:||:.||.|.::|||||.:...|||.||.::.:      .|| :|:.:|   .|..
  Rat   321 GSYDTGMEVWGGENLEFSFRIWQCGGTLETHPCSHVGHVFPK------QAPYSRSKAL---ANSV 376

  Fly   298 RVVDVWLDEYKLHFYRYNPKLRNLTAESLDKPRDLRRRLNCKSFEWYRSQVAPQI-----RNHFL 357
            |..:||:|::|..:|..||:.|......:.:.:.||.:|.||.|:|:...|.|::     |..|.
  Rat   377 RAAEVWMDDFKELYYHRNPQARLEPFGDVTERKKLRAKLQCKDFKWFLDTVYPELHVPEDRPGFF 441

  Fly   358 ----HAGLTNYPIGKIMPFVAPHFCL--------SIKGGFPVIRKCHSTN----FEDWTLTSRCQ 406
                :.||..|             ||        :::|...::..||...    ||   .|||.:
  Rat   442 GMLENRGLRGY-------------CLDYNPPSENNVEGHQVLLYLCHGMGQNQFFE---YTSRQE 490

  Fly   407 LKHG----NMCLDVDYKNNVRATKCTKKLSKNPWHYNYQHSSFV---------SNGNKCL----- 453
            :::.    ..|:.|:...:|    ....|.|:..    ::..||         ....||:     
  Rat   491 IRYNTRQPEACIAVEEGKDV----LIMDLCKDTVXXXXENQEFVLQEDGTLVHKQSGKCVEATEK 551

  Fly   454 QIDVNKVGLILSACDSDVTEQRWMF 478
            :.|.:....:.....||  .|||:|
  Rat   552 EFDTSFAPHLRDCSSSD--NQRWLF 574

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7579NP_648799.1 WcaA 52..336 CDD:223539 102/306 (33%)
pp-GalNAc-T 54..349 CDD:133004 108/317 (34%)
RICIN 367..478 CDD:238092 25/141 (18%)
Ricin_B_lectin 373..476 CDD:279046 24/133 (18%)
Galnt12XP_232988.5 WcaA 129..424 CDD:223539 107/318 (34%)
pp-GalNAc-T 134..428 CDD:133004 108/317 (34%)
Ricin_B_lectin 440..572 CDD:279046 28/154 (18%)
RICIN 442..574 CDD:238092 28/154 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3736
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.