DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7579 and GALNT2

Sequence 1:NP_648799.1 Gene:CG7579 FlyBaseID:FBgn0036528 Length:498 Species:Drosophila melanogaster
Sequence 2:XP_016856452.1 Gene:GALNT2 HGNCID:4124 Length:636 Species:Homo sapiens

Alignment Length:437 Identity:128/438 (29%)
Similarity:207/438 (47%) Gaps:57/438 (13%)


  Fly    17 QYNAWLSERIPLKRTLEDYRDPQCLKINYSSEKTVTVSIVIAIQQEHPHTLLRGIYSVITQTSPY 81
            ::|...|:::.:.|.:.|.|..||.:..:..:...| |:||....|....|||.:.||:.::.|:
Human   103 KFNQVESDKLRMDRAIPDTRHDQCQRKQWRVDLPAT-SVVITFHNEARSALLRTVVSVLKKSPPH 166

  Fly    82 LLKEIVLVHDGHPDLD---LIRHIHHKLPIVIQLEMESSKGIIHARLTGAGVATGDILVFLNGHM 143
            |:|||:||.|...|.:   |:    .|:..|..|..:..:|::.:|:.||..|...:|.||:.|.
Human   167 LIKEIILVDDYSNDPEDGALL----GKIEKVRVLRNDRREGLMRSRVRGADAAQAKVLTFLDSHC 227

  Fly   144 EVTRGWLPPLLEPILLNNQTVTEPIVDAISRESFAYRKLVEPEQLAFDWQL----DHIFLPLDQH 204
            |....||.||||.:..:...|..||:|.|:.::|.|.......:..|||.|    |:: .|..:.
Human   228 ECNEHWLEPLLERVAEDRTRVVSPIIDVINMDNFQYVGASADLKGGFDWNLVFKWDYM-TPEQRR 291

  Fly   205 SWNSLP-KPYPSSQLEGRVFAIDRKWFWHLGGWDEGLRDYGGDALELSLKVWQCGGLILAVPCSR 268
            |....| .|..:..:.|.:|.:|:.:|..||.:|..:..:||:.||:|.:||||||.:..:||||
Human   292 SRQGNPVAPIKTPMIAGGLFVMDKFYFEELGKYDMMMDVWGGENLEISFRVWQCGGSLEIIPCSR 356

  Fly   269 VGIIYKRDELEAQMAPNRNP---SLQVQKNFKRVVDVWLDEYKLHFYRYNPKLRNLTAESLDKPR 330
            ||.::::..      |...|   .....:|.:|..:||:||||..:|...|..||:...::....
Human   357 VGHVFRKQH------PYTFPGGSGTVFARNTRRAAEVWMDEYKNFYYAAVPSARNVPYGNIQSRL 415

  Fly   331 DLRRRLNCKSFEWYRSQVAPQIR--NH------FLHAGLTNYPIGKIMPFVAPHFCLSIKG---- 383
            :||::|:||.|:||...|.|::|  :|      .|..| ||              ||...|    
Human   416 ELRKKLSCKPFKWYLENVYPELRVPDHQDIAFGALQQG-TN--------------CLDTLGHFAD 465

  Fly   384 GFPVIRKCHSTNFED---WTLTSRCQLKHGNMCLDVDYKNNVRATKC 427
            |...:.:||:.....   |.....|:.:........|    ||:..|
Human   466 GVVGVYECHNAGGNQVCAWGSQVTCRPRESRSWGGPD----VRSPSC 508

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7579NP_648799.1 WcaA 52..336 CDD:223539 95/295 (32%)
pp-GalNAc-T 54..349 CDD:133004 101/306 (33%)
RICIN 367..478 CDD:238092 12/69 (17%)
Ricin_B_lectin 373..476 CDD:279046 12/63 (19%)
GALNT2XP_016856452.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3736
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.