DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7579 and GALNT1

Sequence 1:NP_648799.1 Gene:CG7579 FlyBaseID:FBgn0036528 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_065207.2 Gene:GALNT1 HGNCID:4123 Length:559 Species:Homo sapiens

Alignment Length:508 Identity:157/509 (31%)
Similarity:246/509 (48%) Gaps:59/509 (12%)


  Fly     8 DAQLQNEKY---QYNAWLSERIPLKRTLEDYRDPQCLKINYSSEKTVTVSIVIAIQQEHPHTLLR 69
            |.:...|.:   |:|...||.|.|.|:|.|.|...| |.....:...|.|:||....|...||||
Human    71 DQEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGC-KTKVYPDNLPTTSVVIVFHNEAWSTLLR 134

  Fly    70 GIYSVITQTSPYLLKEIVLVHDGHPDLDLIRHIHH-----KLPIVIQLEMESSKGIIHARLTGAG 129
            .::|||.::..::::|||||.|......|.|.:..     |:|:.: :.||...|:|.|||.||.
Human   135 TVHSVINRSPRHMIEEIVLVDDASERDFLKRPLESYVKKLKVPVHV-IRMEQRSGLIRARLKGAA 198

  Fly   130 VATGDILVFLNGHMEVTRGWLPPLLEPILLNNQTVTEPIVDAISRESFAYRKLVEPEQLAFDWQL 194
            |:.|.::.||:.|.|.|.|||.|||..|..:.:||..||:|.||.::|.|....:.....|:|:|
Human   199 VSKGQVITFLDAHCECTVGWLEPLLARIKHDRRTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKL 263

  Fly   195 DHIFLPLDQHSWN------SLPKPYPSSQLEGRVFAIDRKWFWHLGGWDEGLRDYGGDALELSLK 253
            :..:.|:.|...:      :||...|:  :.|.:|:|||.:|..:|.:|.|:..:||:.||:|.:
Human   264 NFRWYPVPQREMDRRKGDRTLPVRTPT--MAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFR 326

  Fly   254 VWQCGGLILAVPCSRVGIIYKRDELEAQMAPNRNP---SLQVQKNFKRVVDVWLDEYKLHFYRYN 315
            :|||||.:..|.||.||.::::      ..|...|   ...:.||.:|:.:||:||:|..||..:
Human   327 IWQCGGTLEIVTCSHVGHVFRK------ATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIIS 385

  Fly   316 PKLRNLTAESLDKPRDLRRRLNCKSFEWYRSQVAP--QIRNHFLHAGLTNYPIGKIMPFVAPHFC 378
            |.:..:....:.....||.:|.||.|.||...:.|  ||..|:       :.:|:|.. |..:.|
Human   386 PGVTKVDYGDISSRVGLRHKLQCKPFSWYLENIYPDSQIPRHY-------FSLGEIRN-VETNQC 442

  Fly   379 L-------SIKGGFPVIRKCHSTNFED-WTLTSRCQLKHGNMCLDVDYKNN-VRATKCTKKLSKN 434
            |       :.|.|   |..||...... ::.|:..:::..::||||...|. |...||.......
Human   443 LDNMARKENEKVG---IFNCHGMGGNQVFSYTANKEIRTDDLCLDVSKLNGPVTMLKCHHLKGNQ 504

  Fly   435 PWHYN-----YQHSSFVSNGNKCLQIDVNKVGLILSACDSDVT-EQRWMFTKV 481
            .|.|:     .||    .|.|:||.....:...:.|..|.:.: .|:|:...|
Human   505 LWEYDPVKLTLQH----VNSNQCLDKATEEDSQVPSIRDCNGSRSQQWLLRNV 553

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7579NP_648799.1 WcaA 52..336 CDD:223539 101/298 (34%)
pp-GalNAc-T 54..349 CDD:133004 106/309 (34%)
RICIN 367..478 CDD:238092 31/126 (25%)
Ricin_B_lectin 373..476 CDD:279046 28/118 (24%)
GALNT1NP_065207.2 Catalytic subdomain A 115..225 44/111 (40%)
pp-GalNAc-T 119..419 CDD:133004 106/309 (34%)
Catalytic subdomain B 285..347 26/64 (41%)
Ricin_B_lectin 432..548 CDD:306998 30/124 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3736
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.