DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7579 and Galnt9

Sequence 1:NP_648799.1 Gene:CG7579 FlyBaseID:FBgn0036528 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_938048.2 Gene:Galnt9 MGIID:2677965 Length:604 Species:Mus musculus

Alignment Length:518 Identity:146/519 (28%)
Similarity:249/519 (48%) Gaps:71/519 (14%)


  Fly     3 ETDLVDAQLQNEKYQYNAWLSERIPLKRTLEDYRDPQCLKINYSSEKTVTVSIVIAIQQEHPHTL 67
            :.|..:.:.:.|.:.|||.||:||.|.||:.|||..:|.:|.| ||....:|:|.....|....:
Mouse   105 QDDSQETEGKFEDFGYNAQLSDRISLDRTIPDYRPKRCRQITY-SEDLPQISVVFIFVNEALSVI 168

  Fly    68 LRGIYSVITQTSPYLLKEIVLVHDGHPDLD----LIRHIHHKLPIVIQLEMESSK-GIIHARLTG 127
            ||.::||:..|...||||::||.|...:::    |.:::|.:.|.::::...|.: |:|.|||.|
Mouse   169 LRSVHSVVNHTPSQLLKEVILVDDNSDNVELKFNLDQYVHKRYPGLVKVVRNSRREGLIRARLQG 233

  Fly   128 AGVATGDILVFLNGHMEVTRGWLPPLLEPILLNNQTVTEPIVDAISRESFAYRKLVEPEQLA--- 189
            ..|||..|:.|.:.|:|...||..|.|..|..:.:.:..|.:|.|...:|      |.:|.|   
Mouse   234 WKVATAPIVGFFDAHVEFNTGWAEPALARIQEDRRRIILPAIDNIKYSTF------EVQQYASAA 292

  Fly   190 --FDWQL--DHIFLPLDQHSWNSLPKPYPSSQLEGRVFAIDRKWFWHLGGWDEGLRDYGGDALEL 250
              ::|.|  .:|..|.|.........|..:..:.|..|.:||::|..:|..|.|:..||.:.:||
Mouse   293 HGYNWGLWCMYIIPPQDWLDRGDESAPIRTPAMIGCSFVVDREYFGDIGLLDPGMEVYGAENIEL 357

  Fly   251 SLKVWQCGGLILAVPCSRVGIIYKRDELEAQMAP-NRNPSLQVQKNFKRVVDVWLDEYKLHFY-R 313
            .::||||||.:..:|||||.      .:|....| |.:.....::|..|..:||:|::|.|.| .
Mouse   358 GMRVWQCGGSMEVLPCSRVA------HIERTKKPYNNDIDYYAKRNALRAAEVWMDDFKSHVYMA 416

  Fly   314 YNPKLRNLTAE--SLDKPRDLRRRLNCKSFEWYRSQVAPQIRNHFLHAGLTNYPIGKIMPFVAPH 376
            :|..:.|...:  .:.:...||.:|.|:||:||...|.|::|   ::.....|  |::....|..
Mouse   417 WNIPMTNPGVDFGDVSERLALREKLKCRSFKWYLENVYPEMR---IYNNTLTY--GEVRNSKASG 476

  Fly   377 FCLSIKGG----FPVIRKCHSTNFEDWTLTSRCQLKHG----------NMCLDVDYKNNV-RATK 426
            :||. :|.    ..::..||..:.:....::...|:.|          :.||..|.:..: ...|
Mouse   477 YCLD-QGAEDDDRAILYPCHGMSSQLVRYSAEGLLQLGPLGSTAFLPDSKCLVDDGRGRMPTLKK 540

  Fly   427 C------TKKLSKNPWHYNYQHSSFVS-NGNKCLQIDVNK-----VGLILSACDSDVTEQRWM 477
            |      |::|    |.:. |....|| :..:||:::::|     :.|::..|..    |:||
Mouse   541 CEDVARPTQRL----WDFT-QSGPIVSRDTGRCLEVEMSKDANFGLRLVVQRCSG----QKWM 594

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7579NP_648799.1 WcaA 52..336 CDD:223539 88/300 (29%)
pp-GalNAc-T 54..349 CDD:133004 95/311 (31%)
RICIN 367..478 CDD:238092 28/139 (20%)
Ricin_B_lectin 373..476 CDD:279046 25/130 (19%)
Galnt9NP_938048.2 pp-GalNAc-T 155..454 CDD:133004 95/311 (31%)
Ricin_B_lectin 465..593 CDD:279046 27/140 (19%)
RICIN 467..595 CDD:238092 28/139 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C94182786
eggNOG 1 0.900 E1_KOG3736
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.