DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7579 and gly-10

Sequence 1:NP_648799.1 Gene:CG7579 FlyBaseID:FBgn0036528 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_001041036.2 Gene:gly-10 WormBaseID:WBGene00001635 Length:703 Species:Caenorhabditis elegans

Alignment Length:541 Identity:179/542 (33%)
Similarity:262/542 (48%) Gaps:99/542 (18%)


  Fly     8 DAQLQNEKYQ------YNAWLSERIPLKRTLEDYRDPQCLKINYSSEKTVTVSIVIAIQQEHPHT 66
            |.:::.|...      |||::|:.|.|.|:::|.|..:|..:.||: |..|||::....:||..|
 Worm   190 DKEVEKEALSLYKANGYNAYISDMISLNRSIKDIRHKECKNMMYSA-KLPTVSVIFPFHEEHNST 253

  Fly    67 LLRGIYSVITQTSPYLLKEIVLVHD-------GHPDLDLIR--HIHHKLPIVIQLEMESSKGIIH 122
            |||.:||||.::.|.|||||:||.|       ..|..|.::  .|.|   ||..|..:..:|:|.
 Worm   254 LLRSVYSVINRSPPELLKEIILVDDFSEKPALRQPLEDFLKKNKIDH---IVKVLRTKKREGLIR 315

  Fly   123 ARLTGAGVATGDILVFLNGHMEVTRGWLPPLLEPILLNNQTVTEPIVDAISRESFAYRKLVEPEQ 187
            .|..||..|||:||:||:.|.|....||||||:||..:.:||..|.||.|..|::..|...|..:
 Worm   316 GRQLGAQDATGEILIFLDAHSEANYNWLPPLLDPIAEDYRTVVCPFVDVIDCETYEVRPQDEGAR 380

  Fly   188 LAFDWQLDHIFLPLDQHSWNSLPKPYPSSQLEGRVFAIDRKWFWHLGGWDEGLRDYGGDALELSL 252
            .:|||..::..|||.:....|..||:.|..:.|..|||..||||.|||:||||..:||:..|||.
 Worm   381 GSFDWAFNYKRLPLTKKDRESPTKPFNSPVMAGGYFAISAKWFWELGGYDEGLDIWGGEQYELSF 445

  Fly   253 KVWQCGGLILAVPCSRVGIIYKRDELEAQMAPNRNPSLQ--VQKNFKRVVDVWLDEYKLHFYRYN 315
            |||||.|.::..|||||..||:     .:.||.:|..:.  |.:|:|||.:||:|:||...|::.
 Worm   446 KVWQCHGRMVDAPCSRVAHIYR-----CKYAPFKNAGMGDFVSRNYKRVAEVWMDDYKETLYKHR 505

  Fly   316 PKLRNLTAESLDKPRDLRRRLNCKSFEWYRSQVAPQIRNHFLHAGLTNYPIGKIMPFVAP----- 375
            |.:.|..|..|...:.:|.:|.||||:|:..::|              :...|..|.|.|     
 Worm   506 PGVGNADAGDLKLMKGIREKLQCKSFDWFMKEIA--------------FDQDKYYPAVEPKASAE 556

  Fly   376 --------HFCLSIK--------GGFPVIRKCHSTN-----FEDWTLTSRCQL--KHGNMCLDVD 417
                    :||:..:        |    :|||.|.:     .:|..||....:  |...:|.|  
 Worm   557 GEIRNVGTNFCIDTQFKEQNQRFG----LRKCTSDDKDGGGEQDLRLTRWHDIRPKGRKICFD-- 615

  Fly   418 YKNNVRATKCTKKLSKNP-----WH-------YNY---QHSSFVSNGNKCLQIDVNKVGLI-LSA 466
                     |:..:.|.|     .|       :.|   |...:.....:||..|.|..|.: :..
 Worm   616 ---------CSTSVDKAPVILFDCHSMKGNQLFKYRVAQKQIYHPISGQCLTADENGKGFLHMKK 671

  Fly   467 CDSDVTEQRWMFTKVQDFKLD 487
            |||....|:|.:..|.:..|:
 Worm   672 CDSSSDLQKWAWQTVDNELLE 692

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7579NP_648799.1 WcaA 52..336 CDD:223539 122/295 (41%)
pp-GalNAc-T 54..349 CDD:133004 126/306 (41%)
RICIN 367..478 CDD:238092 33/155 (21%)
Ricin_B_lectin 373..476 CDD:279046 30/147 (20%)
gly-10NP_001041036.2 pp-GalNAc-T 241..539 CDD:133004 126/306 (41%)
Ricin_B_lectin 555..681 CDD:279046 28/141 (20%)
RICIN 557..681 CDD:238092 28/139 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131093142
eggNOG 1 0.900 E1_KOG3736
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D276134at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11675
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.900

Return to query results.
Submit another query.