DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7579 and gly-3

Sequence 1:NP_648799.1 Gene:CG7579 FlyBaseID:FBgn0036528 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_498722.1 Gene:gly-3 WormBaseID:WBGene00001628 Length:612 Species:Caenorhabditis elegans

Alignment Length:522 Identity:164/523 (31%)
Similarity:257/523 (49%) Gaps:92/523 (18%)


  Fly    11 LQNEKYQYNAWLSERIPLKRTLEDYRDPQCLKINYSSEKTV---TVSIVIAIQQEHPHTLLRGIY 72
            |:|   |:|...||.|.:.|||.|||...| :.:.::.||.   ..||:|....|...||||.::
 Worm   131 LEN---QFNVVASEMISVNRTLPDYRSDAC-RTSGNNLKTAGMPKTSIIIVFHNEAWTTLLRTLH 191

  Fly    73 SVITQTSPYLLKEIVLVHDGHPDLD-LIRHIHHKL---PIVIQL-EMESSKGIIHARLTGAGVAT 132
            |||.::..:||:||:|| |...|.| |::.:...:   ||.|.| .:|:..|:|.|||||:.:|.
 Worm   192 SVINRSPRHLLEEIILV-DDKSDRDYLVKPLDSYIKMFPIPIHLVHLENRSGLIRARLTGSEMAK 255

  Fly   133 GDILVFLNGHMEVTRGWLPPLLEPILLNNQTVTEPIVDAISRESFAYRKLVEPEQLAFDWQLDHI 197
            |.||:||:.|:|||.|||.||:..:..:.:.|..||:|.||.::|.|....|.....|:|.|:  
 Worm   256 GKILLFLDAHVEVTDGWLEPLVSRVAEDRKRVVAPIIDVISDDTFEYVTASETTWGGFNWHLN-- 318

  Fly   198 FLPLDQHSWNSLPK------------PYPSSQLEGRVFAIDRKWFWHLGGWDEGLRDYGGDALEL 250
                  ..|.::||            |..:..:.|.:||||:::|:.:|.:|||::.:||:.||:
 Worm   319 ------FRWYAVPKRELNRRGSDRSMPIQTPTIAGGLFAIDKQFFYDIGSYDEGMQVWGGENLEI 377

  Fly   251 SLKVWQCGGLILAVPCSRVGIIYKRDELEAQMAPNRNP---SLQVQKNFKRVVDVWLDEYKLHFY 312
            |.:||.|||.:...||||||.::::      ..|...|   :..:..|..|..:||:||||..||
 Worm   378 SFRVWMCGGSLEIHPCSRVGHVFRK------QTPYTFPGGTAKVIHHNAARTAEVWMDEYKAFFY 436

  Fly   313 RYNPKLRNLTAESLDKPRDLRRRLNCKSFEWYRSQVAPQ------------IRNHFLHAGL-TNY 364
            :..|..||:.|..:.:.:.||..|.||||:||...:.|:            |.|.|....: || 
 Worm   437 KMVPAARNVEAGDVSERKKLRETLQCKSFKWYLENIYPEAPLPADFRSLGAIVNRFTEKCVDTN- 500

  Fly   365 PIGKIMPFVAPHFCLSIKGGFPVIRKCHST-NFEDWTLTSRCQLKHGNMCLDVDY----KNNVRA 424
              ||            ..|..|.|:.||.. ..:.|:||.:.:::..::||...:    .:.::.
 Worm   501 --GK------------KDGQAPGIQACHGAGGNQAWSLTGKGEIRSDDLCLSSGHVYQIGSELKL 551

  Fly   425 TKCTKKLSKNPWHYNYQHSSFVSNGNKCLQIDVNKVGLILSACDSDVT---------EQRWMFTK 480
            .:|:  :||    .|.:| .||.:......:. .|.|..::..|..||         :|.|....
 Worm   552 ERCS--VSK----INVKH-VFVFDDQAGTLLH-KKTGKCVTGADQRVTLDECGLGRKDQMWQLEG 608

  Fly   481 VQ 482
            .|
 Worm   609 YQ 610

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7579NP_648799.1 WcaA 52..336 CDD:223539 108/304 (36%)
pp-GalNAc-T 54..349 CDD:133004 115/315 (37%)
RICIN 367..478 CDD:238092 26/125 (21%)
Ricin_B_lectin 373..476 CDD:279046 23/117 (20%)
gly-3NP_498722.1 pp-GalNAc-T 173..473 CDD:133004 115/315 (37%)
Glyco_tranf_2_2 173..438 CDD:287123 102/280 (36%)
Ricin_B_lectin 486..604 CDD:279046 30/141 (21%)
RICIN 486..604 CDD:238092 30/141 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3736
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.