DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7579 and galnt2

Sequence 1:NP_648799.1 Gene:CG7579 FlyBaseID:FBgn0036528 Length:498 Species:Drosophila melanogaster
Sequence 2:XP_017949686.1 Gene:galnt2 XenbaseID:XB-GENE-980077 Length:559 Species:Xenopus tropicalis

Alignment Length:501 Identity:145/502 (29%)
Similarity:239/502 (48%) Gaps:60/502 (12%)


  Fly     8 DAQLQNEKYQYNAWLSERIPLKRTLEDYRDPQCLKINYSSEKTVTVSIVIAIQQEHPHTLLRGIY 72
            ||..:|   ::|...|:::.:.|::.|.|..||.|..:..:...| |:||....|....|||.:.
 Frog    85 DAYARN---KFNQVESDKLLMDRSVPDTRHEQCRKKTWRVDLPAT-SVVITFHNEARSALLRTVI 145

  Fly    73 SVITQTSPYLLKEIVLV---HDGHPDLDLIRHIHHKLPIVIQLEMESSKGIIHARLTGAGVATGD 134
            ||:.::..:|:|||:||   .|...|..|:..|..    |..|..:..:|::.:|:.||..|...
 Frog   146 SVLKKSPVHLVKEIILVDDYSDSAEDGALLERIEK----VRVLRNDRREGLMRSRVKGADAAQSK 206

  Fly   135 ILVFLNGHMEVTRGWLPPLLEPILLNNQTVTEPIVDAISRESFAYRKLVEPEQLAFDWQL----D 195
            :|.||:.|.|....||.||||.:..:...|..||:|.|:.::|.|.......:..|||.|    |
 Frog   207 VLTFLDSHCECNEHWLEPLLERVAEDKARVVSPIIDVINMDNFQYVGASADLKGGFDWNLVFKWD 271

  Fly   196 HIFLPLDQHSWNSLP-KPYPSSQLEGRVFAIDRKWFWHLGGWDEGLRDYGGDALELSLKVWQCGG 259
            :: .|..:.:....| .|..:..:.|.:|.:|:.:|..||.:|..:..:||:.||:|.:||||||
 Frog   272 YM-TPEQRRTRQGNPVAPIKTPMIAGGLFVMDKSYFEELGKYDMMMDVWGGENLEISFRVWQCGG 335

  Fly   260 LILAVPCSRVGIIYKRDELEAQMAPNRNP---SLQVQKNFKRVVDVWLDEYKLHFYRYNPKLRNL 321
            .:..:||||||.::::..      |...|   .....:|.:|..:||:|:||..:|...|..||:
 Frog   336 SLEIIPCSRVGHVFRKQH------PYTFPGGSGTVFARNTRRAAEVWMDDYKNFYYAAVPSARNV 394

  Fly   322 TAESLDKPRDLRRRLNCKSFEWYRSQVAPQIR--NH------FLHAGLTNYPIGKIMPFVAPHFC 378
            ...::....:|::.|.||.|:||...|.|::|  :|      .|..| ||              |
 Frog   395 PYGNIQSRLELKKNLGCKPFKWYLENVYPELRVPDHQDIAFGALQQG-TN--------------C 444

  Fly   379 LSIKG----GFPVIRKCHST-NFEDWTLTSRCQLKHGNMCLDVDYK---NNVRATKCTKKLSKNP 435
            |...|    |...:.:||:. ..::|.||....:||.::||.|..:   :.::...|.:..|:..
 Frog   445 LDTLGHFADGVVGVYECHNAGGNQEWALTKDKSVKHMDLCLTVVDRVPGSLIKLQGCRENDSRQK 509

  Fly   436 WHYNYQHSSFVSNG-NKCLQI-DVNKVGLILSACDSDVTEQRWMFT 479
            |.....:|.....| |.||.. :....||.:.||...:::| |.|:
 Frog   510 WEQIENNSKLRHVGSNFCLDSRNAKNGGLTVEACSPSLSQQ-WKFS 554

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7579NP_648799.1 WcaA 52..336 CDD:223539 91/295 (31%)
pp-GalNAc-T 54..349 CDD:133004 97/306 (32%)
RICIN 367..478 CDD:238092 28/121 (23%)
Ricin_B_lectin 373..476 CDD:279046 27/113 (24%)
galnt2XP_017949686.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3736
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.