DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7579 and galnt12

Sequence 1:NP_648799.1 Gene:CG7579 FlyBaseID:FBgn0036528 Length:498 Species:Drosophila melanogaster
Sequence 2:XP_002935181.2 Gene:galnt12 XenbaseID:XB-GENE-986239 Length:597 Species:Xenopus tropicalis

Alignment Length:530 Identity:149/531 (28%)
Similarity:240/531 (45%) Gaps:99/531 (19%)


  Fly     8 DAQLQNE---KYQYNAWLSERIPLKRTLEDYRDPQCLKINYSSEKTVTVSIVIAIQQEHPHTLLR 69
            :.:|:||   |:|.|.:||::|.|.|.||:..:|.|..:.|...:....|::||...|...||||
 Frog   104 EKELENESIHKHQINIYLSDKISLHRRLEERWNPMCKTVKYKYRRLPKTSVIIAFYNEAWSTLLR 168

  Fly    70 GIYSVITQTSPYLLKEIVLVHDGHPDLDLIRHIHHKLPI---------VIQLEMESSKGIIHARL 125
            .::||: :|||.||.|.:::.|.:.|.:     |.|.|:         |..:.....:|::.|||
 Frog   169 TVHSVL-ETSPDLLLEEIILVDDYSDRE-----HLKEPLEKYISSWRKVRLIRANKREGLVRARL 227

  Fly   126 TGAGVATGDILVFLNGHMEVTRGWLPPLLEPILLNNQTVTEPIVDAISRESFAY-RKLVEPEQLA 189
            .||.:|..::|.||:.|.|...|||.||||.|......|..|::|.|...:|.| ....||:...
 Frog   228 LGASIAKAEVLTFLDCHCECHEGWLEPLLERIREKESAVICPVIDVIDWNTFEYLGNAGEPQIGG 292

  Fly   190 FDWQLDHIFLPLDQHSWNSLPKP-----------YPSSQLEGRVFAIDRKWFWHLGGWDEGLRDY 243
            |||::  :|      :|:::|:.           ..|..:.|.:|::.:|:|.|||.:|.|:..:
 Frog   293 FDWRM--VF------TWHTVPETEQKKRRSPIDVISSPTMAGGLFSVSKKYFEHLGSYDTGMEVW 349

  Fly   244 GGDALELSLKVWQCGGLILAVPCSRVGIIYKRDELEAQMAP-NRNPSLQVQKNFKRVVDVWLDEY 307
            ||:.||.|.::|||||.:...|||.||.::.|      .|| :|:.:|   .|..|..:||||||
 Frog   350 GGENLEFSFRIWQCGGSLEVHPCSHVGHVFPR------QAPYSRSKAL---SNSVRAAEVWLDEY 405

  Fly   308 KLHFYRYNPKLRNLTAESLDKPRDLRRRLNCKSFEWYRSQVAPQIR---------NHFLHAGLTN 363
            |..:|..||..|......:.:...|:.||.||.|:|:...:.|::.         ....:.|:.|
 Frog   406 KEIYYHRNPHARKEPYGDVSERLQLKERLQCKHFKWFLDNIYPELHVPEDKPGRFGMLKNKGMEN 470

  Fly   364 YPIGKIMPFVAPHFCL--------SIKGGFPVIRKCH---STNFEDWTLTS--RCQLKHGNMCLD 415
                         .|.        .:.|...::..||   ...|.::|..:  |...:....|..
 Frog   471 -------------VCFDYNPPNENDVSGQQIILYPCHGMGQNQFFEYTSYNEIRYNTRQPEGCAS 522

  Fly   416 VDY-KNNVRATKCTKKLSKNPWHYNYQHSSFVSNG-------NKCLQ----IDVNKVGLILSACD 468
            .|: .:::....|.:...:.|   ..|...|..:|       .||:|    |.......:|..| 
 Frog   523 ADFDSDHLTMFLCRENGQEVP---ENQKFIFRDDGILFHPKTKKCVQAVRNIKNEDPEPVLRPC- 583

  Fly   469 SDVTEQRWMF 478
            |:...|:|.|
 Frog   584 SESDNQKWYF 593

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7579NP_648799.1 WcaA 52..336 CDD:223539 101/306 (33%)
pp-GalNAc-T 54..349 CDD:133004 106/317 (33%)
RICIN 367..478 CDD:238092 23/136 (17%)
Ricin_B_lectin 373..476 CDD:279046 22/128 (17%)
galnt12XP_002935181.2 WcaA 149..443 CDD:223539 106/317 (33%)
pp-GalNAc-T 153..447 CDD:133004 106/317 (33%)
Ricin_B_lectin 459..591 CDD:279046 24/149 (16%)
RICIN 461..593 CDD:238092 25/149 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3736
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.