DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7579 and Galnt15

Sequence 1:NP_648799.1 Gene:CG7579 FlyBaseID:FBgn0036528 Length:498 Species:Drosophila melanogaster
Sequence 2:XP_017455884.1 Gene:Galnt15 RGDID:2322081 Length:717 Species:Rattus norvegicus

Alignment Length:538 Identity:155/539 (29%)
Similarity:231/539 (43%) Gaps:97/539 (18%)


  Fly    19 NAWLSERIPLKRTLEDYRDPQCLKINYSSEKTVTVSIVIAIQQEHPHTLLRGIYSVITQTSPYLL 83
            |..||.|:||:|.|.:.|.|.||: .:......|.|:::....|...||||.::|::......||
  Rat   196 NKPLSARLPLRRVLPEARHPLCLQ-QHPPSGLPTASVILGFHDEAWPTLLRTVHSILDTAPRALL 259

  Fly    84 KEIVLVHD---GHPDLDLIRHIHHKLPIVIQLEMESSKGIIHARLTGAGVATGDILVFLNGHMEV 145
            :||:||.|   ..|....:.....||..|..|......|.|.||:.||..||||:|||::.|.|.
  Rat   260 QEIILVDDLSQQEPLKSALSEYVAKLEAVKLLRSNKRLGTIGARMLGATRATGDVLVFMDAHCEC 324

  Fly   146 TRGWLPPLLEPILLNNQTVTEPIVDAISRESFAY--RKLVEPEQLAFDWQLDHIFLPLDQHSWNS 208
            ..|||.|||..|..:...|..|::|.|..::..|  .||   ::...||:||..:.||.:....:
  Rat   325 HPGWLEPLLSRIADDRSRVVSPVIDVIDWKTLQYSASKL---QRGVLDWKLDFQWEPLREQELKA 386

  Fly   209 LPKPYP---SSQLEGRVFAIDRKWFWHLGGWDEGLRDYGGDALELSLKVWQCGGLILAVPCSRVG 270
            ||.|..   |..:...|.|:||.:|.:.|.:|..|..:|.:.||:|.|.|.|||.:..:||||||
  Rat   387 LPSPISPVRSPVVPQEVVAVDRHYFQNTGAYDPLLSLWGSENLEMSFKAWLCGGSVEILPCSRVG 451

  Fly   271 IIYKRDELEAQMAPNRNPSLQVQKNFKRVVDVWLDEYKLHFYRYNPKLRNLTAESLDKPRDLRRR 335
            .:|     ::|.|..|.....:.||..|:.:.||..:|..|||:.|:     |.:|.|.|..|..
  Rat   452 HLY-----QSQDASLRTDPEVILKNKIRIAETWLSSFKETFYRHIPE-----AFALSKVRRDRAA 506

  Fly   336 LNCKSFEWYRSQVAP-------QIRNH---------------FLHAGLTNYPIGKIMP------- 371
            |:      |...:|.       ||..|               ....|..:..:|.:|.       
  Rat   507 LD------YDGSIAEKPYLILNQIGAHTEKLFQAVRQGGPHDLSQGGQLSVTVGHVMSREDRELE 565

  Fly   372 --------------FVAPHFCLSIKG--------------GFPVIRKCHSTNFEDWTL--TSRCQ 406
                          :|..||.|...|              |.|:.....|.|.:...|  |||.:
  Rat   566 LVKKHPHSGGQIHIYVNVHFQLHSTGLGLCADCRAEGDLLGCPMTLAPCSNNRQQQNLEHTSRKE 630

  Fly   407 LKHGN---MCLDVDYKNNVRATKCTKK-LSKNPWHYNYQHSSFVSN--GNKCLQIDV--NKVGLI 463
            :..|:   :|.|| ....|....||:: .:.:..|:::|....:.:  ..||::..|  :...|.
  Rat   631 ILFGSPQRLCFDV-RGERVILQNCTEEGPAIHQQHWDFQEDGLIIHVLSGKCMEAGVRPSSKDLY 694

  Fly   464 LSACDSDVTEQRWMFTKV 481
            |..||.. |.|.|.|.::
  Rat   695 LRQCDGK-TSQLWRFDQI 711

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7579NP_648799.1 WcaA 52..336 CDD:223539 101/292 (35%)
pp-GalNAc-T 54..349 CDD:133004 102/303 (34%)
RICIN 367..478 CDD:238092 34/156 (22%)
Ricin_B_lectin 373..476 CDD:279046 31/127 (24%)
Galnt15XP_017455884.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C94064652
eggNOG 1 0.900 E1_KOG3736
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.