DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7579 and galnt5

Sequence 1:NP_648799.1 Gene:CG7579 FlyBaseID:FBgn0036528 Length:498 Species:Drosophila melanogaster
Sequence 2:XP_002667267.4 Gene:galnt5 ID: Length:768 Species:Danio rerio

Alignment Length:516 Identity:149/517 (29%)
Similarity:224/517 (43%) Gaps:114/517 (22%)


  Fly    18 YNAWLSERIPLKRTLEDYRDPQCLKINYSSEKTV-----TVSIVIAIQQEHPHTLLRGIYSVITQ 77
            :|.:|||:||:.|.:.|.|...|      ||..|     :.|::.....|...||||.::||:.:
Zfish   309 FNVFLSEQIPIDRAIPDTRPQTC------SESLVHDDLPSTSVIFCFVDEVWSTLLRSVHSVLNR 367

  Fly    78 TSPYLLKEIVLVHDG------HPDLDLIRHIHHKLPIVIQLEMESSKGIIHARLTGAGVATGDIL 136
            :.|.|||||:||.|.      ...||:..   .:.|.|..:.::..:|:|.||:.||..|||::|
Zfish   368 SPPQLLKEIILVDDCSTKDYLKEQLDVYM---SQFPKVRIIHLKERQGLIRARMAGAAAATGEVL 429

  Fly   137 VFLNGHMEVTRGWLPPLLEPILLNNQTVTEPIVDAISRESFAYRKLVEPEQLAFDWQLDHIFLPL 201
            .||:.|:|...|||.||||.|.|:.:.|..|::|.|:.:..:|..:...::..|.|.|  :|   
Zfish   430 TFLDSHIECNVGWLEPLLERIYLDRRKVPCPVIDVINDKDMSYMLVDNFQRGIFKWPL--VF--- 489

  Fly   202 DQHSWNSLPKPYPSSQ--------------LEGRVFAIDRKWFWHLGGWDEGLRDYGGDALELSL 252
               .|::||:.|....              :...:...:||              ..|:......
Zfish   490 ---GWSALPEEYIQKNQIKDSDPIRIACCFIHSHILHNNRK--------------KSGNVFLFVF 537

  Fly   253 KVWQCGGLILAVPCSRVGIIYKRDELEAQMAPNRNP-------SLQVQKNFKRVVDVWLDEYKLH 310
            ::|.|||.|..:||||||.|::.|          ||       ...|::|..||.:|||||||..
Zfish   538 QIWMCGGEIEIIPCSRVGHIFRSD----------NPYKFTKDRVKTVERNLARVAEVWLDEYKEV 592

  Fly   311 FY--RYNPKL-RNLT-AESLDKPRDLRRRLNCKSFEWYRSQVAPQIRNHFLHAGLTNYPIG--KI 369
            ||  .|...| :|:| ..:|.:...||.:|.||||:||...|.|.:....:.|....:.:|  |.
Zfish   593 FYGHGYQHLLDKNVTDIGNLTEQIQLREKLKCKSFKWYLENVYPDLDTPVVKAEGLIFNVGTRKC 657

  Fly   370 MPFVAPHFCLSIKGGFPVIRKCHSTNFEDW-TLTSRCQLKHGNMCLDVDYKNNVRATKCTKKLSK 433
            :.|....|.|:         ||..||...: |.|....|:....||         |.:.| :|:.
Zfish   658 LIFQNESFSLT---------KCDLTNKSQYFTFTWLRLLRQNTSCL---------APQET-QLTM 703

  Fly   434 NPWHYNYQHSSFVSNGNK---------------CLQIDVNKVGLILSACDSDVTEQRWMFT 479
            .|......|..::....|               ||:..:...|:.|..||...|.|:|.||
Zfish   704 EPCDNTKPHLRWIHKSGKALTEHLMAEVYSQPICLEAGIKADGVFLKGCDRFSTFQKWQFT 764

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7579NP_648799.1 WcaA 52..336 CDD:223539 95/315 (30%)
pp-GalNAc-T 54..349 CDD:133004 103/326 (32%)
RICIN 367..478 CDD:238092 29/129 (22%)
Ricin_B_lectin 373..476 CDD:279046 25/119 (21%)
galnt5XP_002667267.4 Glyco_tranf_GTA_type 344..635 CDD:325014 103/326 (32%)
Ricin_B_lectin 647..761 CDD:306998 28/133 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3736
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.