DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7579 and galnt13

Sequence 1:NP_648799.1 Gene:CG7579 FlyBaseID:FBgn0036528 Length:498 Species:Drosophila melanogaster
Sequence 2:XP_005168002.1 Gene:galnt13 ZFINID:ZDB-GENE-091204-444 Length:581 Species:Danio rerio

Alignment Length:517 Identity:157/518 (30%)
Similarity:242/518 (47%) Gaps:76/518 (15%)


  Fly    17 QYNAWLSERIPLKRTLEDYRDPQCLKINYSSEKTVTVSIVIAIQQEHPHTLLRGIYSVITQTSPY 81
            |:|...|:.|.|.|:|.|.|...|....|..:...| ||||....|...||||.::|.|.::...
Zfish    82 QFNLMASDMIALNRSLPDVRLDGCKTKTYPDDLPNT-SIVIVFHNEAWSTLLRTVHSAINRSPRQ 145

  Fly    82 LLKEIVLVHDGHPDLDLIRHIHHKL---------PIVIQLEMESSKGIIHARLTGAGVATGDILV 137
            ||.||:||.|. .:.|.::   .||         |:.| |.||...|:|.|||.||....|.::.
Zfish   146 LLYEILLVDDA-SERDFLK---EKLEDYVATLEVPVRI-LRMEQRTGLIRARLRGAAATRGQVIT 205

  Fly   138 FLNGHMEVTRGWLPPLLEPILLNNQTVTEPIVDAISRESFAYRKLVEPEQLAFDWQLDHIFLPLD 202
            ||:.|.|.|.|||.||:..|..:.:.|..||:|.||.|:|.|....:.....|:|:|:..:.|:.
Zfish   206 FLDAHCECTTGWLEPLMARIKEDRRAVVCPIIDVISDETFEYMAGSDMTYGGFNWKLNFRWYPVP 270

  Fly   203 QHSWN------SLPKPYPSSQLEGRVFAIDRKWFWHLGGWDEGLRDYGGDALELSLKVWQCGGLI 261
            |...:      :||...|:  :.|.:|:|||.:|..:|.:|.|:..:||:.||:|.::|||||.:
Zfish   271 QREMDRRKGDRTLPVRTPT--MAGGLFSIDRTYFEEIGTYDSGMDIWGGENLEMSFRIWQCGGSL 333

  Fly   262 LAVPCSRVGIIYKRDELEAQMAPNRNP---SLQVQKNFKRVVDVWLDEYKLHFYRYNPKLRNLTA 323
            ..|.||.||.::::      ..|...|   ...:.||.:|:.:||:||:|..||..:|.:..:..
Zfish   334 EIVTCSHVGHVFRK------ATPYSFPGGTGQVINKNNRRLAEVWMDEFKDFFYIISPGVVRVDY 392

  Fly   324 ESLDKPRDLRRRLNCKSFEWYRSQVAP--QIRNHFLHAGLTNYPIGKIMPFVAPHFCLSIKG--- 383
            ..:...:.||..|.||.|.||...|.|  ||...:       |.:|:|.. |..:.|:...|   
Zfish   393 GDVSSRKALRESLKCKPFSWYLENVYPDSQIPRRY-------YSLGEIRN-VETNQCVDNMGRKE 449

  Fly   384 ----GFPVIRKCHSTNFED-WTLTSRCQLKHGNMCLDVDYKNN-VRATKC------------TKK 430
                ||   ..||...... ::.|:..:::..::|||....|. |...||            .:.
Zfish   450 NEKVGF---FNCHGMGGNQVFSYTADKEIRTDDLCLDASRLNGPVVMLKCHHMKGNQMFEYDAEY 511

  Fly   431 LSKNPWHYNYQHSSFVS-NGNKCL---QIDVNKVGLILSACDSDVTEQRWM---FTKVQDFK 485
            :.|  |.|:::..:|:. ....||   :::....|..:..|| |...|.|.   ||:.:.||
Zfish   512 VGK--WEYDFKKRTFLHIITQSCLTISRLEDGTYGPTVEYCD-DSPLQAWTLRNFTRQEVFK 570

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7579NP_648799.1 WcaA 52..336 CDD:223539 102/302 (34%)
pp-GalNAc-T 54..349 CDD:133004 108/313 (35%)
RICIN 367..478 CDD:238092 29/139 (21%)
Ricin_B_lectin 373..476 CDD:279046 26/128 (20%)
galnt13XP_005168002.1 Glyco_tranf_2_3 115..359 CDD:290369 89/258 (34%)
pp-GalNAc-T 118..418 CDD:133004 108/313 (35%)
RICIN 431..560 CDD:238092 29/136 (21%)
Ricin_B_lectin 431..558 CDD:279046 28/134 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C94081718
eggNOG 1 0.900 E1_KOG3736
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.