DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7579 and galnt18b

Sequence 1:NP_648799.1 Gene:CG7579 FlyBaseID:FBgn0036528 Length:498 Species:Drosophila melanogaster
Sequence 2:XP_003199061.1 Gene:galnt18b ZFINID:ZDB-GENE-091014-1 Length:609 Species:Danio rerio

Alignment Length:505 Identity:147/506 (29%)
Similarity:240/506 (47%) Gaps:62/506 (12%)


  Fly    16 YQYNAWLSERIPLKRTLEDYRDPQCLKINYSSEKTVTVSIVIAIQQEHPHTLLRGIYSVITQTSP 80
            |.||.:||:|:.:.|.:.|||...|..::|.| ....||||.....|....:||.|:||:.:|..
Zfish   122 YGYNGYLSDRLSMDRAIPDYRPDGCKNMSYPS-NLPQVSIVFIFVNEALSVILRSIHSVMNRTPS 185

  Fly    81 YLLKEIVLVHD--GHPDL-----DLIRHIHHKLPIVIQLEMES-SKGIIHARLTGAGVATGDILV 137
            :|||||:||.|  .:.:|     |.::..:.|.|..|::...| .:|:|.:|::|...|:..::.
Zfish   186 HLLKEIILVDDNSNNDELKEKLQDFVKETNAKQPGFIKVVRHSRQEGLIRSRVSGWRAASAPVVA 250

  Fly   138 FLNGHMEVTRGWLPPLLEPILLNNQTVTEPIVDAISRESFAYRKLVEPEQLAFDWQLDHIFLPLD 202
            ..:.|:|...||..|:|:.|..:...:..|..|.|..::|...:.....| .|||:|...:|...
Zfish   251 LFDAHVEFNIGWAEPILQRIKEDRTRIISPSFDNIKYDTFEIEEYPLSAQ-GFDWELWCRYLNPP 314

  Fly   203 QHSW--NSLPKPYPSSQLEGRVFAIDRKWFWHLGGWDEGLRDYGGDALELSLKVWQCGGLILAVP 265
            :..|  |:...|..|..|.| .|.:||.:|..:|..|||:..|||:.:||.::||||||.:..:|
Zfish   315 KSWWNLNNSTAPIRSPALIG-CFVVDRLYFAEIGLLDEGMEIYGGENVELGVRVWQCGGSVEVLP 378

  Fly   266 CSRVGIIYKRDELEAQMAPNRNPSLQVQKNFKRVVDVWLDEYKLHFYRYNPKLRNLTAE------ 324
            |:|:..|.:     |......:.:..|::|..||.:||:||:|.|.|    ...|:..|      
Zfish   379 CARIAHIER-----AHKPYTEDLTAHVRRNALRVAEVWMDEFKSHVY----MAWNIPQEDSGIDI 434

  Fly   325 -SLDKPRDLRRRLNCKSFEWYRSQVAPQIRNHFLHAGLTNYPIGKIMPFVAPHFCLSIKG----G 384
             .:.:.:.||::|.||:|.||...:.|::|   ::.....|  |.:...:....||. :|    .
Zfish   435 GDIAERKALRKKLQCKTFRWYLVNIYPEMR---MYTDTVAY--GVLRNSLKTDLCLD-QGPDTDN 493

  Fly   385 FPVIRKCHSTNFEDWTLTSRCQLKHG----------NMCLDVDYKNNVRATKCTKKLSKN-PWHY 438
            .|::..||....::...||..||..|          |.|| ||.....|..:|:..::|. ..|:
Zfish   494 IPILYLCHGMTPQNVYYTSTQQLFVGILSPTVDDDDNKCL-VDVNGRPRLIECSYAVAKRMKLHW 557

  Fly   439 NYQHSSFVSN--GNKCLQI---DVNKVG--LILSACDSDVTEQRWMFTKV 481
            .:.....:.|  ..:||::   :.|:.|  |.|..|    |.|.|..|.:
Zfish   558 RFTQGGSIQNTKSKRCLELVENNDNEFGFQLTLQKC----TGQNWTITNM 603

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7579NP_648799.1 WcaA 52..336 CDD:223539 92/301 (31%)
pp-GalNAc-T 54..349 CDD:133004 97/312 (31%)
RICIN 367..478 CDD:238092 32/133 (24%)
Ricin_B_lectin 373..476 CDD:279046 30/125 (24%)
galnt18bXP_003199061.1 pp-GalNAc-T 159..460 CDD:133004 97/312 (31%)
Glyco_tranf_2_2 160..421 CDD:287123 86/272 (32%)
Ricin_B_lectin 471..598 CDD:279046 32/135 (24%)
RICIN 473..600 CDD:238092 32/133 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3736
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.