DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Eig71Ef and Eig71Eh

Sequence 1:NP_524093.2 Gene:Eig71Ef FlyBaseID:FBgn0004593 Length:98 Species:Drosophila melanogaster
Sequence 2:NP_648794.3 Gene:Eig71Eh FlyBaseID:FBgn0014848 Length:101 Species:Drosophila melanogaster

Alignment Length:98 Identity:53/99 (54%)
Similarity:79/99 (80%) Gaps:2/99 (2%)


  Fly     1 MQLTSIICVILFLGCVLINGQSPDCRKLRDTCNPCIRRLNNPINNVEFMNEGCREKVRGRYIWKN 65
            |:||  :|.::.||||:::||||||::::|.|:.||:|||:|.|.|:|:|:|||.:|||.|:||:
  Fly     1 MKLT--VCFLVILGCVIVHGQSPDCKEIKDICSKCIQRLNDPYNKVDFINKGCRNRVRGSYVWKD 63

  Fly    66 QTRCDLQVIACSAHKRKLDCLVIAELAGMPRRT 98
            |..|:||.|||||..|.::|:|||::|.|.|.|
  Fly    64 QNLCELQAIACSAPNRAMNCVVIADVAKMRRVT 96

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Eig71EfNP_524093.2 L71 24..88 CDD:280587 35/64 (55%)
Eig71EhNP_648794.3 L71 22..86 CDD:280587 35/64 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C5000825
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.