DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mrn and TFB2

Sequence 1:NP_648780.1 Gene:mrn FlyBaseID:FBgn0261109 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_015203.1 Gene:TFB2 SGDID:S000006043 Length:513 Species:Saccharomyces cerevisiae

Alignment Length:513 Identity:175/514 (34%)
Similarity:274/514 (53%) Gaps:71/514 (14%)


  Fly    39 EYLRTRQTPESLE-KLYNYPPICLAVFRELPEIARQFIIRILFVDQPVPQAVVTSWGAQRCAKEQ 102
            :||  .:.|:.:: :||..|..|||::|.||.:|:.||:.::|.:..||...:..|.......:.
Yeast    12 QYL--EEIPQQVQNRLYTSPATCLAIYRILPPLAKFFIMAMVFNENEVPLLDLDKWVNSNGKLQF 74

  Fly   103 AEATSCLTALNVWRVTAIP---GGLSAWELSPTFKKSVRQVLLGGGKPWPMTNTLDKDSKPRDIA 164
            ..|...:.:|::    .||   .|.....|:||||.|:|..|.||.........::::....|: 
Yeast    75 QNAIKSMKSLHL----LIPNKSSGTLMINLNPTFKISLRNALTGGEVQNSFGVVVEENVVSLDL- 134

  Fly   165 FLDTYAMSRWRCVLHYMVGTGNRNGTDAEAISPDAVRILLHANLMKRDERDG-ITITRQGFQFLL 228
             ||.|:.::|..:||:||||     ..|:..|...:.:|.|:.||:.....| ..||.:||||||
Yeast   135 -LDEYSANKWETILHFMVGT-----PLAKIPSEKVLNLLKHSKLMEEVNSTGEFKITNEGFQFLL 193

  Fly   229 LDTRAQVWHFMLQYLDTCEERGISLPECLSMLFQLSFSTLGRDYSSEGMNSQMLTFLQHLREFGL 293
            .:..:|:|..:||||...|...:.|.:.|..:|.|....:|:.|..:.::......||.:|::||
Yeast   194 QEINSQLWTLLLQYLKMIETSKMDLVDVLHFIFMLGALEVGKAYKIDALSETQRIMLQDMRDYGL 258

  Fly   294 VFQRKRKEGRFYPTRLALNVTS-KEAAATASVAMDE------------------EATQDC----- 334
            |||:...:..||||:|||.:|| .:...:||.|||.                  ::|.|.     
Yeast   259 VFQKHSNDSIFYPTKLALMLTSDTKTIRSASNAMDSVLRQNREEPSVNEDGANGKSTTDITTSDD 323

  Fly   335 -------------GYIVVETNYRVYAYTDSPLQVAVLGLFTELLYRFPNLVVGVLTRDSVRQALR 386
                         |.::||||:::|:|::||||:|||.||..|..||.|:|:|.:||:|:|:||.
Yeast   324 LNKAGLKNQDIPDGSLIVETNFKIYSYSNSPLQIAVLSLFVHLKARFVNMVLGQITRESIRRALT 388

  Fly   387 GGITAEQIVSYLEQYAHPNM-RMVESAIHSK-----SC------LPPTVVDQIKLWELERNRFTY 439
            .||||:||::|||.:|||.| |:.|..:..|     :|      |||||||||:||:||.:|...
Yeast   389 NGITADQIIAYLETHAHPQMRRLAEEKLEKKLELDPNCKEPLQVLPPTVVDQIRLWQLELDRVIT 453

  Fly   440 TEGVLYNQFLSHTDFVTLRDYAQSIHMLVWQNERTRTMVVQKNGHDDV----KRYWKK 493
            .||.||:.|.:..::..|..|||.|.:|:|::::.:...:.|.|:..|    ||..||
Yeast   454 YEGSLYSDFETSQEYNLLSKYAQDIGVLLWKDDKKKKFFISKEGNSQVLDFAKRKLKK 511

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mrnNP_648780.1 Tfb2 39..403 CDD:281797 135/406 (33%)
TFB2NP_015203.1 Tfb2 9..510 CDD:322604 173/511 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C231606980
eggNOG 1 0.900 E1_COG5144
Hieranoid 1 1.000
Homologene 1 1.000 H7090
Inparanoid 1 1.050 270 1.000 Inparanoid score I593
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003251
OrthoInspector 1 1.000 T1136702
orthoMCL 1 0.900 OOG5_128887
Panther 1 1.100 LDO PTHR13152
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1501
TreeFam 1 0.960
1312.790

Return to query results.
Submit another query.