DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mrn and AT4G17020

Sequence 1:NP_648780.1 Gene:mrn FlyBaseID:FBgn0261109 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_001190745.1 Gene:AT4G17020 AraportID:AT4G17020 Length:482 Species:Arabidopsis thaliana

Alignment Length:444 Identity:140/445 (31%)
Similarity:246/445 (55%) Gaps:23/445 (5%)


  Fly    50 LEKLYNYPPICLAVFRELPEIARQFIIRILFVDQPVPQAVVTSWGAQRCAKEQAEATSCLTALNV 114
            |:||||...||.|:.|.||.:|:::::::|::|.|||..::..|.......:...|...|..|.:
plant    23 LDKLYNNVFICEAILRSLPPLAKKYVLQMLYIDVPVPATMMEEWVLADGTSKHRVAIDRLIQLRI 87

  Fly   115 WRVTAIPGGLSAWELSPTFKKSVRQVLLGGG--KPWPMTNTLDKDSKPRDIAFLDTYAMSRWRCV 177
            :...:.....:::.|:|||:.::::.::.||  ...||.:  |...|...:..|:|||:.:|.|.
plant    88 FSEISDRKRGTSYSLNPTFQNNLQKHIISGGVLPREPMNS--DNAIKLPSLQELETYALKQWECF 150

  Fly   178 LHYMVGTGNRNGTDAEAISPDAVRILLHANLMKRDERDGITITRQGFQFLLLDTRAQVWHFMLQY 242
            |..::.:|  .|.....||...::|.....|.:|| :||..:|..||||||:||.||:|:.:.:|
plant   151 LLQLINSG--QGEKLTGISSSMMKIFQRGLLSQRD-KDGPRLTESGFQFLLMDTNAQLWYIIREY 212

  Fly   243 LDTCEERGISLPECLSMLFQLSFSTLGRDYSSEGMNSQMLTFLQHLREFGLV-FQRKRKEGRFYP 306
            :...|||.:...:.:|.|.:|||...|:.|:...:.......|:.|.:.||| .|:.||:..|.|
plant   213 ILNAEERDVDPADLISFLLELSFHVTGQAYNLNTLTEVQNNTLKDLADLGLVKLQQGRKDSWFIP 277

  Fly   307 TRLALNVTSKEAAATASVAMDEEATQDCGYIVVETNYRVYAYTDSPLQVAVLGLFTELLYRFPNL 371
            |:||.|:         ||::.:.:.:..|::|:|||:|:|||:.|.||..:|.||..:.|:.|||
plant   278 TKLATNL---------SVSLADSSARKEGFVVMETNFRMYAYSTSKLQCEILRLFARIEYQLPNL 333

  Fly   372 VVGVLTRDSVRQALRGGITAEQIVSYLEQYAHPNMRMVESAIHSKSCLPPTVVDQIKLWELERNR 436
            :...:|::|:..|...|||::||:::|:|.:||  |..:..    ..:|..|.|||:|||.:..|
plant   334 IACAITKESLYNAFDNGITSDQIITFLQQNSHP--RCADRV----PSIPENVTDQIRLWETDLQR 392

  Fly   437 FTYTEGVLYNQFLSHTDFVTLRDYAQSIHMLVWQNERTRTMVVQKNGHDDVKRY 490
            ...|:...|::|.|...|....|:|:....|:|::.:...:||:...|:.::.:
plant   393 IEMTQAHFYDEFPSKDVFEAACDFAREWRGLLWEDSKRMRLVVKSEVHNQMREF 446

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mrnNP_648780.1 Tfb2 39..403 CDD:281797 116/356 (33%)
AT4G17020NP_001190745.1 Tfb2 13..365 CDD:281797 116/356 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H7090
Inparanoid 1 1.050 248 1.000 Inparanoid score I1010
OMA 1 1.010
OrthoDB 1 1.010 D466731at2759
OrthoInspector 1 1.000 T193336
orthoMCL 1 0.900 OOG5_128887
Panther 1 1.100 LDO PTHR13152
Phylome 1 0.910 0.667 Consistency score
98.980

Return to query results.
Submit another query.