DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mrn and gtf2h4

Sequence 1:NP_648780.1 Gene:mrn FlyBaseID:FBgn0261109 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_001015845.1 Gene:gtf2h4 XenbaseID:XB-GENE-5871042 Length:455 Species:Xenopus tropicalis

Alignment Length:469 Identity:241/470 (51%)
Similarity:321/470 (68%) Gaps:25/470 (5%)


  Fly    32 LECKDFQEYLRTRQTPESLEKLYNYPPICLAVFRELPEIARQFIIRILFVDQPVPQAVVTSWGAQ 96
            |:||:..|:|: ..:|..|::|||:|..|||||||||.:|:.:::|:||::||:|||.|..|..:
 Frog     8 LKCKNLHEFLQ-ELSPGVLDQLYNHPATCLAVFRELPGLAKNYVMRMLFLEQPLPQAAVALWVKK 71

  Fly    97 RCAKEQAEATSCLTALNVWRVTAIPGGLSAWELSPTFKKSVRQVLLGGGKPWPMTNTL---DKDS 158
            ...||..|.|..||.|.:|....:||||....|:|.|:::::..||||||||.....|   ||..
 Frog    72 ENFKEHEENTQVLTGLRLWHTQQLPGGLQGLILNPIFRENLKIALLGGGKPWADDGCLLGPDKHG 136

  Fly   159 KPRDIAFLDTYAMSRWRCVLHYMVGTGNRNGTDAEAISPDAVRILLHANLMKRDERDGITITRQG 223
            |  |:..||.||..||..:||:||      |:.:.|:|.|..::|:.|.|||.:..:...|:..|
 Frog   137 K--DVVSLDKYAEERWEVILHFMV------GSPSAAVSQDLAQLLIQAGLMKSESGEAPCISSAG 193

  Fly   224 FQFLLLDTRAQVWHFMLQYLDTCEERGISLPECLSMLFQLSFSTLGRDYSSEGMNSQMLTFLQHL 288
            ||||||||.:|:|:||||||.:.|.||:.|.|.||.:|||||||||:|||.|||:..:|||||||
 Frog   194 FQFLLLDTPSQLWYFMLQYLKSAESRGMILVEILSFMFQLSFSTLGKDYSVEGMSDSLLTFLQHL 258

  Fly   289 REFGLVFQRKRKEGRFYPTRLALNVTSKEAAATASVAMDEEATQDCGYIVVETNYRVYAYTDSPL 353
            ||||||||||||..|:||||||:|:.|   ..:.||....:.    |:||||||||:||||||.|
 Frog   259 REFGLVFQRKRKSRRYYPTRLAINLAS---GISGSVVDSHKQ----GFIVVETNYRIYAYTDSEL 316

  Fly   354 QVAVLGLFTELLYRFPNLVVGVLTRDSVRQALRGGITAEQIVSYLEQYAHPNMRMVESAIHSKSC 418
            |:|::.||:|:|||||||||..:||::|:||:..|||||||:.:|...|||.|      :.....
 Frog   317 QIALIALFSEMLYRFPNLVVAQVTRENVQQAIGNGITAEQIIHFLRTRAHPVM------LQQNPV 375

  Fly   419 LPPTVVDQIKLWELERNRFTYTEGVLYNQFLSHTDFVTLRDYAQSIHMLVWQNERTRTMVVQKNG 483
            ||||:.|||:||||||:|..::||||||||||..||..||:||:.:.:||::|...|.|||...|
 Frog   376 LPPTITDQIRLWELERDRLRFSEGVLYNQFLSQVDFELLRNYARDLGVLVFENPAKRVMVVTPGG 440

  Fly   484 HDDVKRYWKKYSKS 497
            |.||||:||:...|
 Frog   441 HSDVKRFWKRQKHS 454

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mrnNP_648780.1 Tfb2 39..403 CDD:281797 189/367 (51%)
gtf2h4NP_001015845.1 Tfb2 12..453 CDD:296357 237/463 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C231585666
eggNOG 1 0.900 E1_COG5144
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H7090
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003251
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.710

Return to query results.
Submit another query.