DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mrn and gtf2h4

Sequence 1:NP_648780.1 Gene:mrn FlyBaseID:FBgn0261109 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_956221.1 Gene:gtf2h4 ZFINID:ZDB-GENE-030131-6779 Length:466 Species:Danio rerio

Alignment Length:468 Identity:248/469 (53%)
Similarity:323/469 (69%) Gaps:19/469 (4%)


  Fly    32 LECKDFQEYLRTRQTPESLEKLYNYPPICLAVFRELPEIARQFIIRILFVDQPVPQAVVTSWGAQ 96
            |:||:..|||: ..|||.|::|||:|..||||:||||.:|:.:::|:||:|.|:|||.|..|..:
Zfish     7 LQCKNLHEYLK-ELTPEILDRLYNHPATCLAVYRELPPLAKNYVMRMLFLDHPLPQAAVALWVKK 70

  Fly    97 RCAKEQAEATSCLTALNVWRVTAIPGGLSAWELSPTFKKSVRQVLLGGGKPWPMTN-TLDKDSKP 160
            ...|:..:..|.||.|.:|....:.|||..:.|:|.||.::|..||||||||.... .|..|...
Zfish    71 GSQKDHDQCVSVLTGLRLWHSQHLQGGLQGFVLNPVFKDNLRIALLGGGKPWADEGANLGPDRHA 135

  Fly   161 RDIAFLDTYAMSRWRCVLHYMVGTGNRNGTDAEAISPDAVRILLHANLMKRDERDGITITRQGFQ 225
            ||:..||.|||.||..:||:||      |:.:.|:|.|..::|:.|.|||.:..:...||..|||
Zfish   136 RDVESLDRYAMERWEVILHFMV------GSPSAAVSQDLAQLLIQAGLMKSETGEAPCITSAGFQ 194

  Fly   226 FLLLDTRAQVWHFMLQYLDTCEERGISLPECLSMLFQLSFSTLGRDYSSEGMNSQMLTFLQHLRE 290
            ||||||.:|:|:|.||||.|.:.||:.|.|.||.||||||||||||||.|||:..:|||||||||
Zfish   195 FLLLDTASQLWYFTLQYLKTAQSRGMDLVEILSFLFQLSFSTLGRDYSVEGMSESLLTFLQHLRE 259

  Fly   291 FGLVFQRKRKEGRFYPTRLAL----NVTSKEAAATASVAMDE-EATQDCGYIVVETNYRVYAYTD 350
            ||||||||||..|:||||||:    .||:..|:.:||.|:.. ..|.|.|:||||||||:||||:
Zfish   260 FGLVFQRKRKSRRYYPTRLAITLAAGVTANPASGSASSALGAIPGTGDTGFIVVETNYRIYAYTN 324

  Fly   351 SPLQVAVLGLFTELLYRFPNLVVGVLTRDSVRQALRGGITAEQIVSYLEQYAHPNMRMVESAIHS 415
            |.||:|::.||:|:|||||||||..:||:||:||:..||||:||:.:|...|||.|      :..
Zfish   325 SELQIALVALFSEMLYRFPNLVVAQVTRESVQQAISNGITAQQIIHFLRTRAHPVM------LKQ 383

  Fly   416 KSCLPPTVVDQIKLWELERNRFTYTEGVLYNQFLSHTDFVTLRDYAQSIHMLVWQNERTRTMVVQ 480
            ...||||:.|||:|||||::|..:|||||||||||..||..|||.||.:.:|||||...|.|||.
Zfish   384 TPVLPPTITDQIRLWELEKDRLQFTEGVLYNQFLSQADFEVLRDRAQGLGVLVWQNPAHRVMVVT 448

  Fly   481 KNGHDDVKRYWKK 493
            .:||.:|||:||:
Zfish   449 PHGHSEVKRFWKR 461

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mrnNP_648780.1 Tfb2 39..403 CDD:281797 195/370 (53%)
gtf2h4NP_956221.1 Tfb2 11..463 CDD:296357 245/465 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C231592738
eggNOG 1 0.900 E1_COG5144
Hieranoid 1 1.000
Homologene 1 1.000 H7090
Inparanoid 1 1.050 487 1.000 Inparanoid score I1366
OMA 1 1.010
OrthoDB 1 1.010 D433426at33208
OrthoFinder 1 1.000 FOG0003251
OrthoInspector 1 1.000 T1054183
orthoMCL 1 0.900 OOG5_128887
Panther 1 1.100 LDO PTHR13152
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1501
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.