DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mrn and tfb2

Sequence 1:NP_648780.1 Gene:mrn FlyBaseID:FBgn0261109 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_596563.1 Gene:tfb2 PomBaseID:SPBC13G1.13 Length:447 Species:Schizosaccharomyces pombe

Alignment Length:468 Identity:182/469 (39%)
Similarity:249/469 (53%) Gaps:45/469 (10%)


  Fly    36 DFQEYLRTRQTPESLEKLYNYPPICLAVFRELPEIARQFIIRILFVDQPVPQAVVTSWGAQRCAK 100
            ||.|.|...      .:||..|..||||||.||.:|||:::.:||...||..:....|.......
pombe    11 DFLEQLPNH------ARLYQKPAACLAVFRLLPILARQYVMSMLFNPMPVALSDFDLWIKLSSKV 69

  Fly   101 EQAEATSCLTALNVWR-----VTAIPGGLSAWELSPTFKKSVRQVLLGGGK----PWPMTNTLDK 156
            .|:|:.:.|..:::::     :|          |:..|:|.....|.|||.    ..|.|   |:
pombe    70 YQSESFNKLVRMHIFQFDGQYIT----------LNSEFRKQFITALTGGGNHNSFGVPCT---DE 121

  Fly   157 DSKPRDIAFLDTYAMSRWRCVLHYMVGTGNRNGTDAEAISP-DAVRILLHANLMKRDERDGITIT 220
            |.....:.|||.||...|..:||:||||       .||..| :.|..||....:....::.:.||
pombe   122 DKHLVTVDFLDAYAKETWETILHFMVGT-------PEAKFPGEGVLSLLKRGGLMSGPKNQLRIT 179

  Fly   221 RQGFQFLLLDTRAQVWHFMLQYLDTCEERGISLPECLSMLFQLSFSTLGRDYSSEGMNSQMLTFL 285
            |.||||||.|..||:|..:|.||...|:..:...:.|..||.|....|||.||.:.:.......|
pombe   180 RAGFQFLLQDINAQIWTLLLDYLKLSEDTHMDPVQVLHFLFMLGSLDLGRAYSVDFLTDTQQIML 244

  Fly   286 QHLREFGLVFQRKRKEGRFYPTRLALNVTSKEAAATASVAMDEEATQDCGYIVVETNYRVYAYTD 350
            :.|||:|||:|||....||||||||..:|:...:....   ..|...|.|:|:||||||:||||.
pombe   245 EDLREYGLVYQRKITSKRFYPTRLATGLTTDYRSLHGK---QSENDDDKGFIIVETNYRLYAYTS 306

  Fly   351 SPLQVAVLGLFTELLYRFPNLVVGVLTRDSVRQALRGGITAEQIVSYLEQYAHPNMRMVESAIHS 415
            ||||:|::|||..|..||.||||||:||||:|:||..||.||||::||..:|||.||      .:
pombe   307 SPLQIAIIGLFANLRARFSNLVVGVITRDSIRRALMNGIAAEQIITYLTTHAHPQMR------SN 365

  Fly   416 KSCLPPTVVDQIKLWELERNRFTYTEGVLYNQFLSHTDFVTLRDYAQSIHMLVWQNERTRTMVVQ 480
            ...||||:||||.|||||:||...|.|:|:..||:.:.|....:||:.:.:|||.:...|...:.
pombe   366 VPLLPPTLVDQIYLWELEKNRLRATPGILFRDFLTDSGFDQAVEYAKELGVLVWDSSLKRMFFIT 430

  Fly   481 KNGHDDVKRYWKK 493
            ..|...:..|.|:
pombe   431 TTGAQPMIAYLKR 443

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mrnNP_648780.1 Tfb2 39..403 CDD:281797 146/374 (39%)
tfb2NP_596563.1 tfb2 8..446 CDD:273180 182/469 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H7090
Inparanoid 1 1.050 292 1.000 Inparanoid score I617
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003251
OrthoInspector 1 1.000 T1125692
orthoMCL 1 0.900 OOG5_128887
Panther 1 1.100 LDO PTHR13152
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1501
TreeFam 1 0.960
1110.960

Return to query results.
Submit another query.