DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mrn and Y73F8A.24

Sequence 1:NP_648780.1 Gene:mrn FlyBaseID:FBgn0261109 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_001263824.1 Gene:Y73F8A.24 WormBaseID:WBGene00013529 Length:485 Species:Caenorhabditis elegans

Alignment Length:522 Identity:156/523 (30%)
Similarity:255/523 (49%) Gaps:73/523 (14%)


  Fly     1 MADTKSGSGRHSAAGGSGNAVLSPLGQGPANLECKDFQEYLRTRQTPESLEKLYNYPPICLAVFR 65
            |:..:..:..|.....|.|:.|              |.::|.| ..|::.::|...|.....::|
 Worm     1 MSSDQPAAAPHLTGTSSKNSCL--------------FLDFLIT-IPPKTRQRLLQKPSCAFFIYR 50

  Fly    66 ELPEIARQFIIRILFVDQ-PVPQAVVTSWGAQRCAKEQAEATSCLTALNVWRVTAIPGGLSAWEL 129
            .||.||:|..|::::... |....|..:       ||..:....|..|.:.......|.|:   :
 Worm    51 MLPPIAQQTTIQLIWKGSFPTASDVEET-------KEIEDQVKLLKDLGLVHRQTTDGKLN---I 105

  Fly   130 SPTFKKS-VRQVLLGGGKPWPMT------NTLDKDSKPRDIAFLDTYAMSRWRCVLHYMVGTGNR 187
            ...:|:| :...:||..:...:.      |...||        ::..|:.||.|:|.|:......
 Worm   106 DTDYKRSYMYAAMLGAAQISSLVLEPNEGNRRGKD--------VEKKAVERWDCILRYLALPSEE 162

  Fly   188 NGTDAEAISPDAVRILLHANLMKRDERDGITITRQGFQFLLLDTRAQVWHFMLQYLDTCEERGIS 252
            |   .:|:|.....:...||.....:.. |.||..|||||||....|:|.::::||.....:|..
 Worm   163 N---TQAVSETTRNLFKKANFTSGGDTQ-IEITTFGFQFLLLSPVKQMWTYVIEYLKLEMSQGQD 223

  Fly   253 LPECLSMLFQL----------SFSTLGRDYS-----SEGMNSQMLTFLQHLREFGLVFQRKRKEG 302
            :.|.:..|.|:          .|......|.     :|..|.    .|.||||.|::|.||||:|
 Worm   224 IVEVIEPLIQIVLLANRVQVAGFKAERECYQIDANWTEPQNE----LLNHLRELGVIFIRKRKDG 284

  Fly   303 RFYPTRLALNVTSKEAAATASVAMDEEATQDCGYIVVETNYRVYAYTDSPLQVAVLGLFTELLYR 367
            .|:.|:|..::.:.|.....|.   |:.:.  |.::||||:||||||.|.||:|::.||||:.||
 Worm   285 VFFLTQLLTHLATNETIDDVSA---EKVSN--GKVIVETNFRVYAYTSSLLQLAIIALFTEMTYR 344

  Fly   368 FPNLVVGVLTRDSVRQALRGGITAEQIVSYLEQYAHPNMRMVESAIHSKSCLPPTVVDQIKLWEL 432
            |.::.||::||:|||.||:.||||.||:|:|...|||........:   :|||.||.|||:|||.
 Worm   345 FQDMSVGMITRESVRGALQHGITAAQIISFLRANAHPQCIATSGPV---NCLPITVADQIRLWED 406

  Fly   433 ERNRFTYTEGVLYNQFLSHTDFVTLRDYAQSIHMLVWQNERTRTMVVQKNGHDDVKRYWKK-YSK 496
            ||.|....:..:|:.|.|..:|..:.:||:..::|:|.:.:.:.::|.::||:.|::::|: .||
 Worm   407 ERRRMNLKDAYIYSHFESEDEFHGVCEYARQQNILLWSDNQQKLVIVNEDGHELVRQWYKREKSK 471

  Fly   497 SG 498
            :|
 Worm   472 TG 473

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mrnNP_648780.1 Tfb2 39..403 CDD:281797 118/387 (30%)
Y73F8A.24NP_001263824.1 Tfb2 25..380 CDD:281797 118/387 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C231598189
eggNOG 1 0.900 E1_COG5144
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 212 1.000 Inparanoid score I2328
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D433426at33208
OrthoFinder 1 1.000 FOG0003251
OrthoInspector 1 1.000 T475407
orthoMCL 1 0.900 OOG5_128887
Panther 1 1.100 LDO PTHR13152
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1501
TreeFam 1 0.960
1312.800

Return to query results.
Submit another query.