DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mrn and Gtf2h4

Sequence 1:NP_648780.1 Gene:mrn FlyBaseID:FBgn0261109 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_034494.1 Gene:Gtf2h4 MGIID:1338799 Length:463 Species:Mus musculus

Alignment Length:474 Identity:242/475 (51%)
Similarity:322/475 (68%) Gaps:22/475 (5%)


  Fly    26 GQGPANLECKDFQEYLRTRQTPESLEKLYNYPPICLAVFRELPEIARQFIIRILFVDQPVPQAVV 90
            |...|:|:|::.||:| ...:|..|::||.:|..|||||||||.:|:.:::|:||::||:|||.|
Mouse     9 GLNRAHLQCRNLQEFL-GGLSPGVLDRLYGHPATCLAVFRELPSLAKNWVMRMLFLEQPLPQAAV 72

  Fly    91 TSWGAQRCAKEQAEATSCLTALNVWRVTAIPGGLSAWELSPTFKKSVRQVLLGGGKPW-PMTNTL 154
            ..|..:..:|.|.|:|..|:.|.:|....:||||....|:|.|::::|..||||||.| ..|:.|
Mouse    73 ALWVKKEFSKAQEESTGLLSGLRIWHTQLLPGGLQGLILNPVFRQNLRIALLGGGKAWSDDTSQL 137

  Fly   155 DKDSKPRDIAFLDTYAMSRWRCVLHYMVGTGNRNGTDAEAISPDAVRILLHANLMKRDE-RDGIT 218
            ..|...||:..||.||..||..|||:||      |:.:.|:|.|..::|..|.|||..| .:...
Mouse   138 GPDKHARDVPSLDKYAEERWEVVLHFMV------GSPSAAVSQDLAQLLSQAGLMKSTEPGEPPC 196

  Fly   219 ITRQGFQFLLLDTRAQVWHFMLQYLDTCEERGISLPECLSMLFQLSFSTLGRDYSSEGMNSQMLT 283
            ||..|||||||||.||:|:||||||.|.:.||:.|.|.||.||||||||||:|||.|||:..:|.
Mouse   197 ITSAGFQFLLLDTPAQLWYFMLQYLQTAQSRGMDLVEILSFLFQLSFSTLGKDYSVEGMSDSLLN 261

  Fly   284 FLQHLREFGLVFQRKRKEGRFYPTRLALNVTSKEAAATASVAMDEEATQDCGYIVVETNYRVYAY 348
            |||||||||||||||||..|:||||||:|::|..:.|..:|       ...|:||||||||:|||
Mouse   262 FLQHLREFGLVFQRKRKSRRYYPTRLAINLSSGVSGAGGTV-------HQPGFIVVETNYRLYAY 319

  Fly   349 TDSPLQVAVLGLFTELLYRFPNLVVGVLTRDSVRQALRGGITAEQIVSYLEQYAHPNMRMVESAI 413
            |:|.||:|::.||:|:||||||:||..:||:||:||:..||||:||:.:|...|||.|      :
Mouse   320 TESELQIALIALFSEMLYRFPNMVVAQVTRESVQQAIASGITAQQIIHFLRTRAHPVM------L 378

  Fly   414 HSKSCLPPTVVDQIKLWELERNRFTYTEGVLYNQFLSHTDFVTLRDYAQSIHMLVWQNERTRTMV 478
            .....||||:.|||:||||||:|..:|||||||||||..||..|..:|:.:.:||::|...|.||
Mouse   379 KQNPVLPPTITDQIRLWELERDRLRFTEGVLYNQFLSQVDFELLLAHARELGVLVFENSAKRLMV 443

  Fly   479 VQKNGHDDVKRYWKKYSKS 497
            |...||.||||:||:...|
Mouse   444 VTPAGHSDVKRFWKRQKHS 462

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mrnNP_648780.1 Tfb2 39..403 CDD:281797 189/366 (52%)
Gtf2h4NP_034494.1 tfb2 19..461 CDD:273180 237/462 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C231589843
eggNOG 1 0.900 E1_COG5144
Hieranoid 1 1.000
Homologene 1 1.000 H7090
Inparanoid 1 1.050 466 1.000 Inparanoid score I1521
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D433426at33208
OrthoFinder 1 1.000 FOG0003251
OrthoInspector 1 1.000 T1085019
orthoMCL 1 0.900 OOG5_128887
Panther 1 1.100 LDO PTHR13152
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1501
TreeFam 1 0.960
1413.800

Return to query results.
Submit another query.