DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mrn and LOC101731871

Sequence 1:NP_648780.1 Gene:mrn FlyBaseID:FBgn0261109 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_001358028.1 Gene:LOC101731871 ID: Length:455 Species:Xenopus tropicalis

Alignment Length:469 Identity:241/470 (51%)
Similarity:321/470 (68%) Gaps:25/470 (5%)


  Fly    32 LECKDFQEYLRTRQTPESLEKLYNYPPICLAVFRELPEIARQFIIRILFVDQPVPQAVVTSWGAQ 96
            |:||:..|:|: ..:|..|::|||:|..|||||||||.:|:.:::|:||::||:|||.|..|..:
 Frog     8 LKCKNLHEFLQ-ELSPGVLDQLYNHPATCLAVFRELPGLAKNYVMRMLFLEQPLPQAAVALWVKK 71

  Fly    97 RCAKEQAEATSCLTALNVWRVTAIPGGLSAWELSPTFKKSVRQVLLGGGKPWPMTNTL---DKDS 158
            ...||..|.|..||.|.:|....:||||....|:|.|:::::..||||||||.....|   ||..
 Frog    72 ENFKEHEENTQVLTGLRLWHTQQLPGGLQGLILNPIFRENLKIALLGGGKPWADDGCLLGPDKHG 136

  Fly   159 KPRDIAFLDTYAMSRWRCVLHYMVGTGNRNGTDAEAISPDAVRILLHANLMKRDERDGITITRQG 223
            |  |:..||.||..||..:||:||      |:.:.|:|.|..::|:.|.|||.:..:...|:..|
 Frog   137 K--DVVSLDKYAEERWEVILHFMV------GSPSAAVSQDLAQLLIQAGLMKSESGEAPCISSAG 193

  Fly   224 FQFLLLDTRAQVWHFMLQYLDTCEERGISLPECLSMLFQLSFSTLGRDYSSEGMNSQMLTFLQHL 288
            ||||||||.:|:|:||||||.:.|.||:.|.|.||.:|||||||||:|||.|||:..:|||||||
 Frog   194 FQFLLLDTPSQLWYFMLQYLKSAESRGMILVEILSFMFQLSFSTLGKDYSVEGMSDSLLTFLQHL 258

  Fly   289 REFGLVFQRKRKEGRFYPTRLALNVTSKEAAATASVAMDEEATQDCGYIVVETNYRVYAYTDSPL 353
            ||||||||||||..|:||||||:|:.|   ..:.||....:.    |:||||||||:||||||.|
 Frog   259 REFGLVFQRKRKSRRYYPTRLAINLAS---GISGSVVDSHKQ----GFIVVETNYRIYAYTDSEL 316

  Fly   354 QVAVLGLFTELLYRFPNLVVGVLTRDSVRQALRGGITAEQIVSYLEQYAHPNMRMVESAIHSKSC 418
            |:|::.||:|:|||||||||..:||::|:||:..|||||||:.:|...|||.|      :.....
 Frog   317 QIALIALFSEMLYRFPNLVVAQVTRENVQQAIGNGITAEQIIHFLRTRAHPVM------LQQNPV 375

  Fly   419 LPPTVVDQIKLWELERNRFTYTEGVLYNQFLSHTDFVTLRDYAQSIHMLVWQNERTRTMVVQKNG 483
            ||||:.|||:||||||:|..::||||||||||..||..||:||:.:.:||::|...|.|||...|
 Frog   376 LPPTITDQIRLWELERDRLRFSEGVLYNQFLSQVDFELLRNYARDLGVLVFENPAKRVMVVTPGG 440

  Fly   484 HDDVKRYWKKYSKS 497
            |.||||:||:...|
 Frog   441 HSDVKRFWKRQKHS 454

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mrnNP_648780.1 Tfb2 39..403 CDD:281797 189/367 (51%)
LOC101731871NP_001358028.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H7090
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D433426at33208
OrthoFinder 1 1.000 FOG0003251
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.