DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: dop and wts

Sequence 1:NP_001261884.1 Gene:dop FlyBaseID:FBgn0267390 Length:2139 Species:Drosophila melanogaster
Sequence 2:NP_733403.1 Gene:wts FlyBaseID:FBgn0011739 Length:1105 Species:Drosophila melanogaster

Alignment Length:1256 Identity:304/1257 (24%)
Similarity:454/1257 (36%) Gaps:430/1257 (34%)


  Fly   200 YTA---------LLRKISYQQHTNSLRAVSGETSNLLRMRHSSLGKSAPCLTGNYFRHELTAPLP 255
            |||         |.|......|.|:        .|...:|:::.......||.:|..    |..|
  Fly    16 YTAEALESIKQDLTRFEVQNNHRNN--------QNYTPLRYTATNGRNDALTPDYHH----AKQP 68

  Fly   256 VQPPGFGASPL---------------GGHNISRSGSCAGIGL----------------------- 282
            ::||. .|||.               |..:||.||  .|:|:                       
  Fly    69 MEPPP-SASPAPDVVIPPPPAIVGQPGAGSISVSG--VGVGVVGVANGRVPKMMTALMPNKLIRK 130

  Fly   283 --------AKHH-------------------HHHHLHGVVMRGSAGGGAGSGGGSSSGVAHHRLS 320
                    :.|:                   |.||.|....| :.|...|:||.|.|......::
  Fly   131 PSIERDTASSHYLRCSPALDSGAGSSRSDSPHSHHTHQPSSR-TVGNPGGNGGFSPSPSGFSEVA 194

  Fly   321 LVT----NSAAVAAAGGSRTHSPYSASPVD--SPRLNSPMPFAFAPIKRIASCRGVVADGRRWSV 379
            ...    |..|.:||.......|.|.:.|.  ||.||:..|....|.:|                
  Fly   195 PPAPPPRNPTACSAATPPPPVPPTSQAYVKRRSPALNNRPPAIAPPTQR---------------- 243

  Fly   380 ASLPSSGYGTTP-----GSSNLSSQCSSQEGLNQLAHNIPPG------VQEADAAAVAAGACCAE 433
                    |.:|     |..|...|.:.|  |..|  |:.||      |:......:..||..| 
  Fly   244 --------GNSPVITQNGLKNPQQQLTQQ--LKSL--NLYPGGGSGAVVEPPPPYLIQGGAGGA- 295

  Fly   434 HLKQHCPKHCALLLAVSQKQLTPQPPKPT---QLQPQKSMTAACVNCCAELSVTCGGQQAG--GG 493
                                 .|.||.|:   .:|.::|.|.:              ||:.  ..
  Fly   296 ---------------------APPPPPPSYTASMQSRQSPTQS--------------QQSDYRKS 325

  Fly   494 AANGGSSANSSGS-SAMQVGGRMSPYFRPRSRSLSSPSRSPIVDNEIAVMNTLYKERFPKATQQM 557
            .::|..||.|:|| |.:.|....:|..:|:.|...:.|:.||:...:            |:||..
  Fly   326 PSSGIYSATSAGSPSPITVSLPPAPLAKPQPRVYQARSQQPIIMQSV------------KSTQVQ 378

  Fly   558 EERLKLFI---NENKSAACNSFRDSQPIVRFVHHQVLEMARDCLHKSEAKLITSQYFYELSENLE 619
            :..|:..:   :.:.::|.||     |:      .||........||.|.:...|.....:...:
  Fly   379 KPVLQTAVAPQSPSSASASNS-----PV------HVLAAPPSYPQKSAAVVQQQQQAAAAAHQQQ 432

  Fly   620 RLLVETKEKSPEAAAELNGVIKKLLLIISRPARLLECLEFDPQEFYELLEAAEGHAKAMPVIKAD 684
            ....::|..:|        ....|:.:.|:|    .|||  |..:.:.::     |||..|::..
  Fly   433 HQHQQSKPPTP--------TTPPLVGLNSKP----NCLE--PPSYAKSMQ-----AKAATVVQQQ 478

  Fly   685 IPQYIIHKLGLNRDPIAELQQELRETQQMCSEQVTV------------------------DADPL 725
            ..|        .:......||::::.||...:|:..                        |...|
  Fly   479 QQQ--------QQQQQQVQQQQVQQQQQQQQQQLQALRVLQAQAQRERDQRERDQRERERDQQKL 535

  Fly   726 ---HPGGSLLLNSPLTSAAKQLSSLALDA-----IAMDSGSGTATPQQPPQTPVATCDTAPSFAL 782
               :||..:|...|..|.....|.:...:     |.:.:.:...||..||               
  Fly   536 ANGNPGRQMLPPPPYQSNNNNNSEIKPPSCNNNNIQISNSNLATTPPIPP--------------- 585

  Fly   783 AISQMNEEKGGSSSAVGGGSSSKVAGAEGITGGSAATATGS------------------------ 823
                  .:...:||..|..||   .|:.|.||.:|:::|..                        
  Fly   586 ------AKYNNNSSNTGANSS---GGSNGSTGTTASSSTSCKKIKHASPIPERKKISKEKEEERK 641

  Fly   824 --GAQQPSPQENDFDIVKLISN------------------------------------------- 843
              ..:|.|||...|.:.:.|.|                                           
  Fly   642 EFRIRQYSPQAFKFFMEQHIENVIKSYRQRTYRKNQLEKEMHKVGLPDQTQIEMRKMLNQKESNY 706

  Fly   844 ---------------------GAYGAVYLV-KHKTTRQRFAMKKINKNNLILRNQVEQVFAERDI 886
                                 ||:|.|.|| |..|:...:|||.:.|.:::.||||..|.|||||
  Fly   707 IRLKRAKMDKSMFVKLKPIGVGAFGEVTLVSKIDTSNHLYAMKTLRKADVLKRNQVAHVKAERDI 771

  Fly   887 LSFADNPFVVSMYCSFETKKHLCLVMEYVEGGDCGTLLKNIGPLPADMARFYFAETVLAVEYLHS 951
            |:.|||.:||.:|.||:.|.:|..||:|:.|||..:||..:|....::||||.||...||:.:|.
  Fly   772 LAEADNNWVVKLYYSFQDKDNLYFVMDYIPGGDLMSLLIKLGIFEEELARFYIAEVTCAVDSVHK 836

  Fly   952 YGIVHRDLKPDNLLITALGHIKLTDFGL-------------SKMGLMSLATNL--YEGYIDS--- 998
            .|.:|||:||||:||...||||||||||             .:.|..|...::  :|.|.::   
  Fly   837 MGFIHRDIKPDNILIDRDGHIKLTDFGLCTGFRWTHNSKYYQENGNHSRQDSMEPWEEYSENGPK 901

  Fly   999 ----ETRQFSDKQ------VYGTPEYIAPEVILRQGYGKPVDWWSMGIILYEFLIGCVPFFGETT 1053
                |.|:..|.|      :.|||.||||||:.|.||.:..|:||:|:||||.|:|..||...:.
  Fly   902 PTVLERRRMRDHQRVLAHSLVGTPNYIAPEVLERSGYTQLCDYWSVGVILYEMLVGQPPFLANSP 966

  Fly  1054 EELFAHTVNDDIEWPDSEDWPVQA----EAKDIISQLLQQNPRDRLGTQSGALEMKEHEYFLGMD 1114
            .|    |....|.|..:...|.||    ||.|:|.:|.....: |||  ....|:|.|::|.|:|
  Fly   967 LE----TQQKVINWEKTLHIPPQAELSREATDLIRRLCASADK-RLG--KSVDEVKSHDFFKGID 1024

  Fly  1115 WNSLLRQKAEFVPQLSHDDDTSYFDTRMD----RYNHDL--GGEDTDDTDDTPVFGSFNSYTPQY 1173
            :..:.:|||.::|::.|..|||.||. :|    |.|...  .|:|.|..|.|  |..|..:|  :
  Fly  1025 FADMRKQKAPYIPEIKHPTDTSNFDP-VDPEKLRSNDSTMSSGDDVDQNDRT--FHGFFEFT--F 1084

  Fly  1174 RKQHYSWSRHATPTSTDGAKP 1194
            |:   .:.....|..||...|
  Fly  1085 RR---FFDDKQPPDMTDDQAP 1102

Known Domains:


GeneSequenceDomainRegion External IDIdentity
dopNP_001261884.1 DUF1908 344..702 CDD:286070 74/380 (19%)
STKc_MAST 834..1115 CDD:270760 127/378 (34%)
S_TKc 835..1110 CDD:214567 124/372 (33%)
PDZ_signaling 1506..1587 CDD:238492
wtsNP_733403.1 STKc_LATS 717..1078 CDD:270749 143/371 (39%)
S_TKc 719..1020 CDD:214567 121/308 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C118686572
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24356
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.