DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AGO2 and AGO1

Sequence 1:NP_730054.1 Gene:AGO2 FlyBaseID:FBgn0087035 Length:1217 Species:Drosophila melanogaster
Sequence 2:NP_001185169.1 Gene:AGO1 AraportID:AT1G48410 Length:1050 Species:Arabidopsis thaliana

Alignment Length:1084 Identity:336/1085 (31%)
Similarity:486/1085 (45%) Gaps:192/1085 (18%)


  Fly   206 QQRPPGQQQGGHQQGRQGQEGGYQQRPSGQQQGGHQQGRQGQEGGYQQRPPGQQQGGHQQGRQGQ 270
            ::|.....:||...|         .|.:|...||   ||..|.||:|| ..||.|||.       
plant     4 KRRTDAPSEGGEGSG---------SREAGPVSGG---GRGSQRGGFQQ-GGGQHQGGR------- 48

  Fly   271 EGGYQQRPPGQQQGGHEQGRQGQEGGYQQRPSGQQQ-GGHQQGRQGQEGGYQQRPSGQQQGG--H 332
              ||..:|   |||    ||.|:  ||.|.|..||| ||.|:        ||    |:.:||  |
plant    49 --GYTPQP---QQG----GRGGR--GYGQPPQQQQQYGGPQE--------YQ----GRGRGGPPH 90

  Fly   333 QQGRQGQEGGYQQRPSGQQQGGHQQG-----RQGQEGGYQ---QRP------PGQQPNQTQSQGQ 383
            |.||.|..||   |..|...|..|:.     .|.....||   .:|      |.|.|..|....|
plant    91 QGGRGGYGGG---RGGGPSSGPPQRQSVPELHQATSPTYQAVSSQPTLSEVSPTQVPEPTVLAQQ 152

  Fly   384 YQ----SRGPPQQQQAAPLP-------LPPQPAGSIKRGTIGKPGQVGINYL-----DLDLSKMP 432
            ::    .:|.| .|...|:|       .|.:|.    :|..||...|..|:.     |.||    
plant   153 FEQLSVEQGAP-SQAIQPIPSSSKAFKFPMRPG----KGQSGKRCIVKANHFFAELPDKDL---- 208

  Fly   433 SVAYHYDVKIMPERPKK-----FYRQAFEQFRVDQLGGAVLAYDGKASCYSVDKLPLNSQNPEVT 492
               :||||.|.||...:     ..:|..:.:|...||..:.||||:.|.|:...||.||:...:.
plant   209 ---HHYDVTITPEVTSRGVNRAVMKQLVDNYRDSHLGSRLPAYDGRKSLYTAGPLPFNSKEFRIN 270

  Fly   493 VTD--------RNGRTLRYTIEIKETGDSTIDLKSLTTYMNDRIFDKPMRAMQCVEVVLAS-PCH 548
            :.|        |..|..:..|::.    :..||..|..::..:..|.|..|:|.:::||.. |..
plant   271 LLDEEVGAGGQRREREFKVVIKLV----ARADLHHLGMFLEGKQSDAPQEALQVLDIVLRELPTS 331

  Fly   549 N-KAIRVGRSFFKMSDPNNRHELDDGYEALVGLYQAFMLGDRP-----FLNVDISHKSFPISMPM 607
            . :.|.|||||:. .|...:..|.||.|:..|.||:.    ||     .||:|:|..:|..:.|:
plant   332 RIRYIPVGRSFYS-PDIGKKQSLGDGLESWRGFYQSI----RPTQMGLSLNIDMSSTAFIEANPV 391

  Fly   608 IEYLERFSLKAKINNTTNLDYSRRFLEPFLRGINVVYTPPQSFQSAPRVYRVNGLSRAPASSETF 672
            |:::... |...|::....|..|..::..|||:.|..|...:.:   |.||::||:.......||
plant   392 IQFVCDL-LNRDISSRPLSDADRVKIKKALRGVKVEVTHRGNMR---RKYRISGLTAVATRELTF 452

  Fly   673 EHDGKKV--TIASYFH-SRNYPLKFPQLHCLNVGSSIKSILLPIELCSIEEGQALNRKDGATQVA 734
            ..|.:..  ::..||| :..:.::..||.||.||:|.:...||:|:|.|.|||..:::....|:.
plant   453 PVDERNTQKSVVEYFHETYGFRIQHTQLPCLQVGNSNRPNYLPMEVCKIVEGQRYSKRLNERQIT 517

  Fly   735 NMIKYAATSTNVRKRKIMNLLQYFQHNLDPTISRFGIRIANDFIVVSTRVLSPPQVEYHS---KR 796
            .::|........|::.|:..:|...:..|.....|||:|:.....|..|:|.||.::||.   :.
plant   518 ALLKVTCQRPIDREKDILQTVQLNDYAKDNYAQEFGIKISTSLASVEARILPPPWLKYHESGREG 582

  Fly   797 FTMVKNGSWRMDGMKFLEPKPKAHKCAVLYCDPRSGRKMNYTQLN---------------DFGNL 846
            ..:.:.|.|.|...|.:                ..|...|:..:|               :...:
plant   583 TCLPQVGQWNMMNKKMI----------------NGGTVNNWICINFSRQVQDNLARTFCQELAQM 631

  Fly   847 IISQGKAVNIS-LDSDVTYRPFTDDERSLDTIFADL--KRSQH---DLAIVIIPQFRIS-YDTIK 904
            ....|.|.|.. :...|:.|| ...|:.|.|.:.|.  |.||.   ||.|||:|....| |..:|
plant   632 CYVSGMAFNPEPVLPPVSARP-EQVEKVLKTRYHDATSKLSQGKEIDLLIVILPDNNGSLYGDLK 695

  Fly   905 QKAELQHGILTQCIKQFTVERKCNNQTIGNILLKINSKLNGINHKIKD--DPRLPMMKN--TMYI 965
            :..|.:.||::||.....| .|.:.|.:.|:.||||.|:.|.|..:.|  ..|:|::.:  |:..
plant   696 RICETELGIVSQCCLTKHV-FKMSKQYMANVALKINVKVGGRNTVLVDALSRRIPLVSDRPTIIF 759

  Fly   966 GADVTHPSPDQREIPSVVGVAASHD-PYGASYNMQYRLQRGALEEIEDMF-------------SI 1016
            |||||||.|.:...||:..|.||.| |....|......|....|.|:|:|             .:
plant   760 GADVTHPHPGEDSSPSIAAVVASQDWPEITKYAGLVCAQAHRQELIQDLFKEWKDPQKGVVTGGM 824

  Fly  1017 TLEHLRVYKEYRNAYPDHIIYYRDGVSDGQFPKIKNEELRCIKQACD--KVGCKPKICCVIVVKR 1079
            ..|.|..::......|..||:||||||:|||.::...||..|::||.  :.|.:|.:..|:|.||
plant   825 IKELLIAFRRSTGHKPLRIIFYRDGVSEGQFYQVLLYELDAIRKACASLEAGYQPPVTFVVVQKR 889

  Fly  1080 HHTRFFPS--GDVTTSNKFNNVDPGTVVDRTIVHPNEMQFFMVSHQAIQGTAKPTRYNVIENTGN 1142
            ||||.|..  .|..:.::..|:.||||||..|.||.|..|::.||..||||::|..|:|:.:..|
plant   890 HHTRLFAQNHNDRHSVDRSGNILPGTVVDSKICHPTEFDFYLCSHAGIQGTSRPAHYHVLWDENN 954

  Fly  1143 LDIDLLQQLTYNLCHMFPRCNRSVSYPAPAYLAHLVAARGRVYL 1186
            ...|.||.||.|||:.:.||.||||...|||.|||.|.|.|.|:
plant   955 FTADGLQSLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRARFYM 998

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AGO2NP_730054.1 PLN03202 411..1180 CDD:215631 262/844 (31%)
ArgoN 411..543 CDD:293095 41/150 (27%)
ArgoL1 554..601 CDD:285861 19/52 (37%)
PAZ 605..719 CDD:239207 34/117 (29%)
Piwi_ago-like 764..1186 CDD:240015 158/469 (34%)
AGO1NP_001185169.1 Gly-rich_Ago1 79..172 CDD:289530 30/109 (28%)
PLN03202 163..1050 CDD:215631 271/880 (31%)
ArgoN 182..325 CDD:293095 42/158 (27%)
ArgoL1 338..387 CDD:285861 20/54 (37%)
PAZ_argonaute_like 390..502 CDD:239212 34/116 (29%)
Piwi_ago-like 547..998 CDD:240015 158/469 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR22891
Phylome 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.