DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AGO2 and AGO2

Sequence 1:NP_730054.1 Gene:AGO2 FlyBaseID:FBgn0087035 Length:1217 Species:Drosophila melanogaster
Sequence 2:NP_174413.2 Gene:AGO2 AraportID:AT1G31280 Length:1014 Species:Arabidopsis thaliana

Alignment Length:1054 Identity:300/1055 (28%)
Similarity:463/1055 (44%) Gaps:183/1055 (17%)


  Fly   247 QEGGYQQRPPGQQQGGHQQGRQGQEG-GYQQRPPGQQQGGHEQGR-QGQEGGYQQRPSGQQQGGH 309
            :.|||        :||...|| |:.| ||     |...||.|||| :|..||.|.|..|.::|| 
plant     2 ERGGY--------RGGRGDGR-GRGGRGY-----GGGGGGGEQGRDRGYGGGEQGRGRGSERGG- 51

  Fly   310 QQGRQGQEGGYQQRPSGQQQGGHQQGRQGQEGGYQQRPSGQ----------QQGGHQQGRQGQEG 364
              |.:||..|.||....|.|.|...|..|:.....|:|..|          ...|...|..|: |
plant    52 --GNRGQGRGEQQDFRSQSQRGPPPGHGGRGTTQFQQPRPQVAPQPSQAPASYAGSVGGVAGR-G 113

  Fly   365 GYQQRPPGQQPNQTQSQGQYQSRGPPQQQQAAPLPLPP--QPAGSIKRGTIGKPGQVG------- 420
            .:.::|  |.|:.:.|.....:......:.|..:.|.|  |.|.|.::..:.:|.:.|       
plant   114 AWGRKP--QVPSDSASPSTSTTVVSEPVRVAEVMNLKPSVQVATSDRKEPMKRPDRGGVVAVRRV 176

  Fly   421 ---INYLDLDLSKMPSVAYHYDVKIMPERP-KKFYRQAFEQFRV---------DQLGGAVLAYDG 472
               :|:..::.:. .||..||||:|..|.| ||..|  ||...|         |:...|:.||||
plant   177 NLYVNHYKVNFNP-ESVIRHYDVEIKGEIPTKKVSR--FELAMVRDKVFTDNPDEFPLAMTAYDG 238

  Fly   473 KASCYSVDKLPLNSQNPEVTVTDR-NGRTLRYTIEIKETGDSTIDLKSLTTYMNDRIFDKPMRAM 536
            :.:.:|..:||..|...|...|:. .||:  ||..||:.  :.:.|..|..||..|....|...:
plant   239 QKNIFSAVELPTGSYKVEYPKTEEMRGRS--YTFTIKQV--NVLKLGDLKEYMTGRSSFNPRDVL 299

  Fly   537 QCVEVVLASPCHNKAIRVGRSFF-KMSDPNN------------RHELDDGYEALVGLYQAFMLGD 588
            |.::||:........|.||:||| :.::|:.            ||.|....:.|           
plant   300 QGMDVVMKEHPSKCMITVGKSFFTRETEPDEDFRFGVIAAKGYRHTLKPTAQGL----------- 353

  Fly   589 RPFLNVDISHKSFPISMPMIEYLERFSLKAKINNTTNLDYSRRFLEPFLRGINVVYTPPQSFQSA 653
              .|.:|.|..:|..:|.:|||     ||...|.:....:.||.:|..|.|:.|.....::.|..
plant   354 --SLCLDYSVLAFRKAMSVIEY-----LKLYFNWSDMRQFRRRDVEEELIGLKVTVNHRKNKQKL 411

  Fly   654 PRVYRVNGLSRAPASSETF---EHDG----KKVTIASYF---HSRNYPLKFPQLHCLNVGSSIKS 708
            ..|    |||........|   :.:|    :|.:|..||   :.|:...|  .:.||::|.:.:.
plant   412 TIV----GLSMQNTKDIKFDLIDQEGNEPPRKTSIVEYFRIKYGRHIVHK--DIPCLDLGKNGRQ 470

  Fly   709 ILLPIELCSIEEGQALNRKDGATQVANMIKYAATSTNVRKRKIMNLLQYFQHNLD--------PT 765
            ..:|:|.|.:.||| :..||      |:.|.:|..  ::|..::| .|..|.|:|        |:
plant   471 NFVPMEFCDLVEGQ-IYPKD------NLDKDSALW--LKKLSLVN-PQQRQRNIDKMIKARNGPS 525

  Fly   766 ----ISRFGIRIANDFIVVSTRVLSPPQVEYHSKRFTMVKNGSWRMDGMKFLEPKPKAHK----- 821
                |..||:::..:...|..|||..|.::. ::|..:|:.           ||.|:.:.     
plant   526 GGEIIGNFGLKVDTNMTPVEGRVLKAPSLKL-AERGRVVRE-----------EPNPRQNNQWNLM 578

  Fly   822 ------------CAVLYCDPRSGRKMNYTQLNDFGNLIISQGKAVNISLDSDVTYRPFTDDERSL 874
                        .|||  |..:..:.| ...|||.:.:|.:...:.:.:::.:.|:....:..|.
plant   579 KKGVTRGSIVKHWAVL--DFTASERFN-KMPNDFVDNLIDRCWRLGMQMEAPIVYKTSRMETLSN 640

  Fly   875 DTIFADLKRSQHDLA----------IVIIPQFR--ISYDTIKQKAELQHGILTQCIKQFTVERKC 927
            .....:|.||..|.|          :|:....|  ..|.|:|..||.:.|::|||...... .|.
plant   641 GNAIEELLRSVIDEASRKHGGARPTLVLCAMSRKDDGYKTLKWIAETKLGLVTQCFLTGPA-TKG 704

  Fly   928 NNQTIGNILLKINSKLNGINHKIKDDPRLPMMK---NTMYIGADVTHPSPDQREIPSVVGVAASH 989
            .:|...|:.||:|:|:.|.|.::.|  .....|   ..|:|||||.||:...:..||:|.|..:.
plant   705 GDQYRANLALKMNAKVGGSNVELMD--TFSFFKKEDEVMFIGADVNHPAARDKMSPSIVAVVGTL 767

  Fly   990 D-PYGASYNMQYRLQRGALEEIEDMFSITLEHLRVYKEYRNAYPDHIIYYRDGVSDGQFPKIKNE 1053
            : |....|..:...|....|||:......||.::.:.:.....|:.|:.:||||||.||..:.|.
plant   768 NWPEANRYAARVIAQPHRKEEIQGFGDACLELVKAHVQATGKRPNKIVIFRDGVSDAQFDMVLNV 832

  Fly  1054 ELRCIKQACDKVGCKPKICCVIVVKRHHTRFFPSGDVTTSNKFNNVDPGTVVDRTIVHPNEMQFF 1118
            ||..:|...:|.|..|||..::..|||.|||||:.:...|:| .||..|||||..::||.|..|:
plant   833 ELLDVKLTFEKNGYNPKITVIVAQKRHQTRFFPATNNDGSDK-GNVPSGTVVDTKVIHPYEYDFY 896

  Fly  1119 MVSHQAIQGTAKPTRYNVIENTGNLDIDLLQQLTYNLCHMFPRCNRSVSYPAPAYLAHLVAARGR 1183
            :.||....||:|||.|..:.:......|.:|:|.:.:|..|.||.:.||...|.|.|.:||.|||
plant   897 LCSHHGGIGTSKPTHYYTLWDELGFTSDQVQKLIFEMCFTFTRCTKPVSLVPPVYYADMVAFRGR 961

  Fly  1184 VYLTGTNRFLDLKK 1197
            :|...::|..:.|:
plant   962 MYHEASSREKNFKQ 975

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AGO2NP_730054.1 PLN03202 411..1180 CDD:215631 240/858 (28%)
ArgoN 411..543 CDD:293095 45/153 (29%)
ArgoL1 554..601 CDD:285861 13/60 (22%)
PAZ 605..719 CDD:239207 32/124 (26%)
Piwi_ago-like 764..1186 CDD:240015 138/459 (30%)
AGO2NP_174413.2 PLN03202 137..957 CDD:215631 252/908 (28%)
ArgoN 164..306 CDD:293095 45/163 (28%)
ArgoL1 317..366 CDD:285861 13/61 (21%)
PAZ 383..488 CDD:280352 30/115 (26%)
Piwi_ago-like 528..963 CDD:240015 136/459 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR22891
Phylome 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.