DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AGO2 and AGO10

Sequence 1:NP_730054.1 Gene:AGO2 FlyBaseID:FBgn0087035 Length:1217 Species:Drosophila melanogaster
Sequence 2:NP_001190464.1 Gene:AGO10 AraportID:AT5G43810 Length:988 Species:Arabidopsis thaliana

Alignment Length:949 Identity:270/950 (28%)
Similarity:424/950 (45%) Gaps:139/950 (15%)


  Fly   335 GRQGQEGGYQQRPSGQQQGGHQQGRQGQEGGYQQRPPGQQPNQTQSQ-------------GQYQS 386
            ||:..:|....|||.:                .::||  .|:||.|.             .....
plant    73 GRKSDQGDVCMRPSSR----------------PRKPP--PPSQTTSSAVSVATAGEIVAVNHQMQ 119

  Fly   387 RGPPQQQQAAPLPLPPQPAGSIKRGTIGKPGQVGINYLDLDLSKMPSVAYH-YDVKIMPERPKKF 450
            .|..:....||.|         ..||:|....|..|:.   |:.:|:...: |||.|.||...|.
plant   120 MGVRKNSNFAPRP---------GFGTLGTKCIVKANHF---LADLPTKDLNQYDVTITPEVSSKS 172

  Fly   451 YRQAF-----EQFRVDQLGGAVLAYDGKASCYSVDKLPLNSQNPEVTVTDR-----NG--RTLRY 503
            ..:|.     ..::...||..:.||||:.|.|:..:||...:...|.:.|.     ||  |...|
plant   173 VNRAIIAELVRLYKESDLGRRLPAYDGRKSLYTAGELPFTWKEFSVKIVDEDDGIINGPKRERSY 237

  Fly   504 TIEIKETGDSTIDLKSLTTYMNDRIFDKPMRAMQCVEVVLASPCHNKAIRVGRSFFKMSDPNNRH 568
            .:.||..  :..::..|..::..:..|.|..|:|.:::||......:...||||||. .|.....
plant   238 KVAIKFV--ARANMHHLGEFLAGKRADCPQEAVQILDIVLRELSVKRFCPVGRSFFS-PDIKTPQ 299

  Fly   569 ELDDGYEALVGLYQAFMLGDRP-----FLNVDISHKSFPISMPMIEYLERFSLKAKINNTTNLDY 628
            .|.:|.|:..|.||:.    ||     .||:|::..:|...:|:||::.:...|..::...: |.
plant   300 RLGEGLESWCGFYQSI----RPTQMGLSLNIDMASAAFIEPLPVIEFVAQLLGKDVLSKPLS-DS 359

  Fly   629 SRRFLEPFLRGINVVYTPPQSFQSAPRVYRVNGLSRAPASSETFEHDGKKVTIAS---YFHSR-N 689
            .|..::..|||:.|..|...:.:   |.|||.||:..|.....|..| :..|:.|   ||... .
plant   360 DRVKIKKGLRGVKVEVTHRANVR---RKYRVAGLTTQPTRELMFPVD-ENCTMKSVIEYFQEMYG 420

  Fly   690 YPLKFPQLHCLNVGSSIKSILLPIELCSIEEGQALNRKDGATQVANMIKYAATSTNVRKRKIMNL 754
            :.::...|.||.||:..|:..||:|.|.|.|||...::....|:..::|........|:..|:..
plant   421 FTIQHTHLPCLQVGNQKKASYLPMEACKIVEGQRYTKRLNEKQITALLKVTCQRPRDRENDILRT 485

  Fly   755 LQYFQHNLDPTISRFGIRIANDFIVVSTRVLSPPQVEYH---SKRFTMVKNGSWRMDGMKFLEPK 816
            :|:..::.||....||:.|:.....|..|:|..|.::||   .::..:.:.|.|.|...|.:...
plant   486 VQHNAYDQDPYAKEFGMNISEKLASVEARILPAPWLKYHENGKEKDCLPQVGQWNMMNKKMINGM 550

  Fly   817 PKAHKCAVLYCDPRSGRKMNYTQ--LNDFGNLIISQGKAVN----ISLDSDVTYRPFTDDERSLD 875
            ..:....|.:  .||.:: |..:  .|:.|.:....|...|    |.:.|   .|| ...|::|.
plant   551 TVSRWACVNF--SRSVQE-NVARGFCNELGQMCEVSGMEFNPEPVIPIYS---ARP-DQVEKALK 608

  Fly   876 TIF----ADLKRSQHDLAIVIIPQFRIS-YDTIKQKAELQHGILTQCIKQFTVERKCNNQTIGNI 935
            .::    ...|..:.:|.:.|:|....| |..:|:..|.:.|:::||.....| .|.:.|.:.|:
plant   609 HVYHTSMNKTKGKELELLLAILPDNNGSLYGDLKRICETELGLISQCCLTKHV-FKISKQYLANV 672

  Fly   936 LLKINSKLNGINHKIKD--DPRLPMMKN--TMYIGADVTHPSPDQREIPSVVGVAASHD-PYGAS 995
            .||||.|:.|.|..:.|  ..|:|::.:  |:..|||||||...:...||:..|.||.| |....
plant   673 SLKINVKMGGRNTVLVDAISCRIPLVSDIPTIIFGADVTHPENGEESSPSIAAVVASQDWPEVTK 737

  Fly   996 YNMQYRLQRGALEEIEDMFSITLEHLR-------------VYKEYRNAYPDHIIYYRDGVSDGQF 1047
            |......|....|.|:|::....:.:|             .:::.....|..||:||||||:|||
plant   738 YAGLVCAQAHRQELIQDLYKTWQDPVRGTVSGGMIRDLLISFRKATGQKPLRIIFYRDGVSEGQF 802

  Fly  1048 PKIKNEELRCIKQACDKV--GCKPKICCVIVVKRHHTRFFPSG--DVTTSNKFNNVDPGTVVDRT 1108
            .::...||..|::||..:  ..:|.:..::|.||||||.|.:.  |..::::..|:.||||||..
plant   803 YQVLLYELDAIRKACASLEPNYQPPVTFIVVQKRHHTRLFANNHRDKNSTDRSGNILPGTVVDTK 867

  Fly  1109 IVHPNEMQFFMVSHQAIQGTAKPTRYNVIENTGNLDIDLLQQLTYNLCHMFPRCNRSVSYPAPAY 1173
            |.||.|..|::.||..||||::|..|:|:.:..|...|.:|.||.|||:.:.||.||||...|||
plant   868 ICHPTEFDFYLCSHAGIQGTSRPAHYHVLWDENNFTADGIQSLTNNLCYTYARCTRSVSIVPPAY 932

  Fly  1174 LAHLVAARGRVYLTGTNRFLDLKKEYAKRTIVPEFMKKN 1212
            .|||.|.|.|.||.                  ||.|:.|
plant   933 YAHLAAFRARFYLE------------------PEIMQDN 953

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AGO2NP_730054.1 PLN03202 411..1180 CDD:215631 246/827 (30%)
ArgoN 411..543 CDD:293095 39/145 (27%)
ArgoL1 554..601 CDD:285861 18/52 (35%)
PAZ 605..719 CDD:239207 35/118 (30%)
Piwi_ago-like 764..1186 CDD:240015 146/458 (32%)
AGO10NP_001190464.1 PLN03202 131..988 CDD:215631 255/874 (29%)
ArgoN 131..275 CDD:293095 40/158 (25%)
ArgoL1 286..335 CDD:285861 19/54 (35%)
PAZ_argonaute_like 336..450 CDD:239212 35/119 (29%)
Piwi_ago-like 495..945 CDD:240015 146/458 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR22891
Phylome 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.