DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AGO2 and AGO9

Sequence 1:NP_730054.1 Gene:AGO2 FlyBaseID:FBgn0087035 Length:1217 Species:Drosophila melanogaster
Sequence 2:NP_197613.2 Gene:AGO9 AraportID:AT5G21150 Length:896 Species:Arabidopsis thaliana

Alignment Length:869 Identity:220/870 (25%)
Similarity:381/870 (44%) Gaps:137/870 (16%)


  Fly   398 LPLPPQPAGSIKRGTIGKPGQVGINYLDLDLSKMPSVAYHYDVKIMPE--RP-------KKFYRQ 453
            ||: .:|.||   |:.|:...:..|:..:..:|.....:||.|.|..|  ||       :|...:
plant    35 LPM-ARPRGS---GSKGQKIPLLTNHFGVKFNKPSGYFFHYSVAINYEDGRPVEAKGIGRKILDK 95

  Fly   454 AFEQFRVDQLGGAVLAYDGKASCYSVDKLPLNSQNPEVTVTD---------------------RN 497
            ..|.::.| ||....||||:.:.::|..||.|..:..|.:.:                     |.
plant    96 VQETYQSD-LGAKYFAYDGEKTLFTVGALPSNKLDFSVVLEEIPSSRNHAGNDTNDADRKRSRRP 159

  Fly   498 GRTLRYTIEIKETGDSTIDLKSLTTYMNDRIFDKPMRAMQCVEVVL-ASPCHNKAIRVGRSFFKM 561
            .:|.::.:||...  :.|.::::.:.:..:..:....|::.::::| .|......:.|.:|||. 
plant   160 NQTKKFMVEISYA--AKIPMQAIASALQGKETENLQDALRVLDIILRQSAARQGCLLVRQSFFH- 221

  Fly   562 SDPNNRHELDDGYEALVGLYQAFMLGDRPF-LNVDISHKSFPISMPMIEYLERFSLKAKINNTTN 625
            :|..|...:..|.....|.:.:|....... ||:|.|........|::::|.....|   .:...
plant   222 NDVKNFVPIGGGVSGCRGFHSSFRTTQGGLSLNIDTSTTMIVQPGPVVDFLLANQNK---KDPYG 283

  Fly   626 LDYSRRFLEPFLRGINVVYTPPQSFQSAPRVYRVNGLSRAPASSETF---------EHDGKKVTI 681
            :|:::  ....|:.:.|..|      .:.|.|:::|||......:.|         |.:..::|:
plant   284 MDWNK--ARRVLKNLRVQIT------LSNREYKISGLSEHSCKDQLFTWRKPNDKGEFEEVEITV 340

  Fly   682 ASYFHSRN----YPLKFPQLHCLNVGSSIKSILLPIELCSIEEGQALNRKDGATQVANMIKYAAT 742
            .:|:..||    |...||   |:|||...:....|||.|::...|...:.....|.|.:::.:..
plant   341 LNYYKERNIEVRYSGDFP---CINVGKPKRPTYFPIEFCNLVSLQRYTKSLTNFQRAALVEKSRQ 402

  Fly   743 STNVRKRKIMNLLQYFQHNLDPTISRFGIRIANDFIVVSTRVLSPPQVEY-HSKRFTMVKNGSWR 806
            ....|...:...|:...:|.||.:...|:.|..:|..|..|:|..|.::. ..:..:.:| |.|.
plant   403 KPPERMASLTKGLKDSNYNADPVLQDSGVSIITNFTQVEGRILPTPMLKVGKGENLSPIK-GKWN 466

  Fly   807 MDGMKFLEPKPKAHKCAVLY---CDPRSGRKMNYTQLNDFGNLIISQGKAVNISLDSDVTYRPFT 868
            .......||........|.:   ||..       |.:.|    :|..|:...|:::.     ||.
plant   467 FMRKTLAEPTTVTRWAVVNFSARCDTN-------TLIRD----LIKCGREKGINVEP-----PFK 515

  Fly   869 D--DER----------SLDTIFADLKRS--QHDLAIVIIPQFRISYDTI---KQKAELQHGILTQ 916
            |  :|.          .::.:|..:|..  :..|.::.|...|.:.|..   |:|..:..||:||
plant   516 DVINENPQFRNAPATVRVENMFEQIKSKLPKPPLFLLCILAERKNSDVYGPWKKKNLVDLGIVTQ 580

  Fly   917 CIKQFTVERKCNNQTIGNILLKINSKLNGINH--KIKDDPRLPMMKN--TMYIGADVTHPSPDQR 977
            ||    ...:.|:|.:.|:|||||:||.|:|.  .::..|.:|.:..  |:.:|.||:|.||.|.
plant   581 CI----APTRLNDQYLTNVLLKINAKLGGLNSLLAMERSPAMPKVTQVPTIIVGMDVSHGSPGQS 641

  Fly   978 EIPSVVGVAASHD-PYGASYNMQYRLQRGALEEIEDMF------------SITLEHLRVYKEYRN 1029
            :|||:..|.:|.. |..:.|....|.|...:|.|:::|            .:.|:   .|....|
plant   642 DIPSIAAVVSSRQWPLISKYKACVRTQSRKMEMIDNLFKPVNGKDEGMFRELLLD---FYYSSEN 703

  Fly  1030 AYPDHIIYYRDGVSDGQFPKIKNEELRCIKQACDKVG--CKPKICCVIVVKRHHTRFFPSGDVTT 1092
            ..|:|||.:|||||:.||.::.|.||..:.|||..:.  ..||...::..|.|||:||.|...  
plant   704 RKPEHIIIFRDGVSESQFNQVLNIELDQMMQACKFLDDTWHPKFTVIVAQKNHHTKFFQSRGP-- 766

  Fly  1093 SNKFNNVDPGTVVDRTIVHPNEMQFFMVSHQAIQGTAKPTRYNVIENTGNLDIDLLQQLTYNLCH 1157
                :||.|||::|..|.||....|::.:|..:.||.:||.|:|:.:......|.||:|.::|.:
plant   767 ----DNVPPGTIIDSQICHPRNFDFYLCAHAGMIGTTRPTHYHVLYDEIGFATDDLQELVHSLSY 827

  Fly  1158 MFPRCNRSVSYPAPAYLAHLVAAR 1181
            ::.|...::|..||...|||.||:
plant   828 VYQRSTTAISVVAPVCYAHLAAAQ 851

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AGO2NP_730054.1 PLN03202 411..1180 CDD:215631 214/854 (25%)
ArgoN 411..543 CDD:293095 31/162 (19%)
ArgoL1 554..601 CDD:285861 13/48 (27%)
PAZ 605..719 CDD:239207 29/127 (23%)
Piwi_ago-like 764..1186 CDD:240015 133/459 (29%)
AGO9NP_197613.2 PLN03202 17..896 CDD:215631 220/870 (25%)
ArgoN 39..203 CDD:293095 34/170 (20%)
ArgoL1 215..264 CDD:285861 13/50 (26%)
PAZ 281..394 CDD:280352 28/124 (23%)
Piwi_ago-like 424..851 CDD:240015 133/457 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR22891
Phylome 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.