DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AGO2 and AT5G21030

Sequence 1:NP_730054.1 Gene:AGO2 FlyBaseID:FBgn0087035 Length:1217 Species:Drosophila melanogaster
Sequence 2:NP_001331316.1 Gene:AT5G21030 AraportID:AT5G21030 Length:854 Species:Arabidopsis thaliana

Alignment Length:915 Identity:230/916 (25%)
Similarity:366/916 (40%) Gaps:206/916 (22%)


  Fly   389 PPQQQQAAPLPLPPQPAGSIKRGTIGKPGQ---VGINYLDLDLSKMPS-VAYHYDVKI-----MP 444
            |||..:..||..........:||. |..||   :..|:..::..|..| ..:||.|.|     .|
plant     7 PPQHMEREPLKSKSSLLPMTRRGN-GSKGQKILLLTNHFRVNFRKPNSHNFFHYSVTITYEDGSP 70

  Fly   445 ERPKKFYRQAFEQFRVDQ-----LGGAVLAYDGKASCYSVDKLPLNSQNPEVTVTDRNGRTLRYT 504
            ...|.|.|:..|  :|.|     ||....||||..:.|:|..||.:|.:..|.:.         |
plant    71 LLAKGFGRKILE--KVQQTCQADLGCKHFAYDGDKNLYTVGPLPRSSLDFSVVLE---------T 124

  Fly   505 IEIKETGDSTIDLKSLTTYMNDRIFDKP-----------------------MRAMQCVEVVLASP 546
            ...:...|..:.|...:...|..|...|                       :|.|.|  ::..:.
plant   125 APSRRNADKRLKLPHQSKKFNVAILFAPPEIPMEAIANALQGKKTKHLLDAIRVMDC--ILSQNA 187

  Fly   547 CHNKAIRVGRSFFKMSDPNNRHELDDGYEALVGLYQAFMLGDRPF-LNVDISHKSFPISMPMIEY 610
            .....:.|.:|||. :|......:.:|.:...|.:.:|....... ||:|:|........|::::
plant   188 ARQGCLLVRQSFFH-NDAKYFANIGEGVDCCKGFHSSFRTTQGGLSLNIDVSTAMIVKPGPVVDF 251

  Fly   611 L-------ERFSLK-AKINNTTNLDYSRRFLEPFLRGINVVYTPPQSFQSAPRVYRVNGLSRAPA 667
            |       :.||:. .|..||             |:.:.|...|      :.:.|::.|||....
plant   252 LIANQGVNDPFSINWKKAKNT-------------LKNLRVKVLP------SNQEYKITGLSGLHC 297

  Fly   668 SSETF---------EHDGKKVTIASYF-HSRNYPLKFP-QLHCLNVGSSIKSILLPIELCSIEEG 721
            ..:||         |.:..::|::.|| ..|...|::. .|.|:|||...:....|||||.:...
plant   298 KDQTFTWKKRNQNREFEEVEITVSDYFTRIREIELRYSGGLPCINVGKPNRPTYFPIELCELVSL 362

  Fly   722 QALNRKDGATQVANMIKYAATSTNVRKRKIMNLLQYFQHNLDPTISRFGIRIANDFIVVSTRVLS 786
            |...:.....|.:|:||.:..:...|...:...|:...:|.||.:...|:||.:||..|..|||.
plant   363 QRYTKALTKFQRSNLIKESRQNPQQRIGVLTRALKTSNYNDDPMLQECGVRIGSDFTQVEGRVLP 427

  Fly   787 PPQVEYHSKRFTMVKNGSWRMDGMKFLEPKPKAHKCAVLY---CDPRSGRKMNYTQLNDFGNLII 848
            .|:::...::.....||||......|.:|........|.:   |||:.               ||
plant   428 TPKLKAGKEQDIYPINGSWNFKNKTFFKPATVTRWAVVNFSARCDPQK---------------II 477

  Fly   849 SQ----GKAVNISLDSDVTYRPFTDDERSLDTIFADLKRSQHDLAIVIIPQFRISYDTIKQKAEL 909
            ..    ||...|::||     |:       ..:|.:            .|||:.:..:::.....
plant   478 DDLTRCGKMKGINVDS-----PY-------HVVFEE------------NPQFKDATGSVRVDKMF 518

  Fly   910 QH--GILTQCIKQFTV-----------ERKC--------------NNQTIGNILLKINSKLNGIN 947
            ||  .||.:...:|.:           |:.|              |:|.:.|:|||||:||.|:|
plant   519 QHLQSILGEVPPKFLLCILEKKNSDVYEKSCSMWNCECIVPPQNLNDQYLTNLLLKINAKLGGLN 583

  Fly   948 H----KIKDDPRLPMMKNTMYIGADVTHPSPDQRE-IPSVVGVAASHD-PYGASYNMQYRLQRGA 1006
            .    ::.....|.|...|:.||.||:|.||.|.: |||:..|.:|.: |..:.|....|.|...
plant   584 SVLDMELSGTMPLVMRVPTIIIGMDVSHGSPGQSDHIPSIAAVVSSREWPLISKYRACVRTQSPK 648

  Fly  1007 LEEIEDMF---------SITLEHLRVYKEYRNAYPDHIIYYRDGVSDGQFPKIKNEELRCIKQAC 1062
            :|.|:.:|         .|..|.|..:.......|:|||.:|||||:.||.::.|.||..:.|. 
plant   649 VEMIDSLFKPVSDKDDQGIMRELLLDFHSSSGKKPNHIIIFRDGVSESQFNQVLNIELDQMMQI- 712

  Fly  1063 DKVGCKPKICCVIVVKRHHTRFFPSGDVTTSNKFNNVDPGTVVDRTIVHPNEMQFFMVSHQAIQG 1127
                            .|||:||      .:...|||.|||::|..|.|.:...|::.:|....|
plant   713 ----------------NHHTKFF------QTESPNNVLPGTIIDSNICHQHNNDFYLCAHAGKIG 755

  Fly  1128 TAKPTRYNVIENTGNLDIDLLQQLTYNLCHMFPRCNRSVSYPAPAYLAHLVAARGRVYLTGTNRF 1192
            |.:||.|:|:.:....|.|.||:|.::|.:::.|...::|..||...|||.||:    :....:|
plant   756 TTRPTHYHVLYDEIGFDTDQLQELVHSLSYVYQRSTTAISLVAPICYAHLAAAQ----MATAMKF 816

  Fly  1193 LDLKK 1197
            .|:.:
plant   817 EDMSE 821

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AGO2NP_730054.1 PLN03202 411..1180 CDD:215631 221/875 (25%)
ArgoN 411..543 CDD:293095 39/169 (23%)
ArgoL1 554..601 CDD:285861 12/48 (25%)
PAZ 605..719 CDD:239207 32/133 (24%)
Piwi_ago-like 764..1186 CDD:240015 130/471 (28%)
AT5G21030NP_001331316.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR22891
Phylome 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.