DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AGO2 and ago2

Sequence 1:NP_730054.1 Gene:AGO2 FlyBaseID:FBgn0087035 Length:1217 Species:Drosophila melanogaster
Sequence 2:XP_009292643.1 Gene:ago2 ZFINID:ZDB-GENE-110606-6 Length:898 Species:Danio rerio

Alignment Length:911 Identity:275/912 (30%)
Similarity:430/912 (47%) Gaps:118/912 (13%)


  Fly   335 GRQGQEGGYQQRPSGQQQGGHQQGRQGQEGGYQQRPPGQQPNQTQSQGQYQSRGPPQQQQAAPLP 399
            |..|....:|.|||           .|.:......||..|        :|..: |||:...    
Zfish     5 GAAGATELFQGRPS-----------SGSDVSAPASPPAPQ--------EYVFK-PPQRPDF---- 45

  Fly   400 LPPQPAGSIKRGTIGKPGQVGINYLDLDLSKMPSVAYHYDVKIMPER-PKKFYRQAFE----QFR 459
                       ||:|:..::..|:.::::.|:.  .|||::.|.||: |::..|:..|    .|:
Zfish    46 -----------GTMGRTIKLQANFFEMEIPKLE--VYHYEIDIKPEKCPRRVNREIVEHMVQHFK 97

  Fly   460 VDQLGGAVLAYDGKASCYSVDKLPLNSQNPEVTVT-DRNGRTLRYTIEIKETGDSTIDLKSLTTY 523
            ....|.....|||:.:.|:...||:.....|:.|| ...|:...:.:.||..  |.:.|::|...
Zfish    98 TQIFGDRKPVYDGRKNLYTAMPLPIGRDKVELEVTIPGEGKDRSFKVAIKWM--SCVSLQALHEA 160

  Fly   524 MNDRIFDKPMRAMQCVEVVLASPCHNKAIR---VGRSFFKMSDPNNRHELDDGYEALVGLYQAFM 585
            ::.|:.:.|...:|.::||:.   |..::|   ||||||..|: ...:.|..|.|...|.:|:. 
Zfish   161 LSGRLPNIPFETIQALDVVMR---HLPSMRYTPVGRSFFTPSE-GCSNPLGGGREVWFGFHQSV- 220

  Fly   586 LGDRP-----FLNVDISHKSFPISMPMIEYL-ERFSLKAKINNTTNLDYSRR--FLEPFLRGINV 642
               ||     .||:|:|..:|..:.|:||:: |....|:.......|..|:|  |.:. ::|:.|
Zfish   221 ---RPSLWKMMLNIDVSATAFYKAQPVIEFMCEVLDFKSIEEQQKPLTDSQRVKFTKE-IKGLKV 281

  Fly   643 VYTPPQSFQSAPRVYRVNGLSRAPASSETF---EHDGKKV--TIASYFHSR-NYPLKFPQLHCLN 701
            ..|.....:   |.|||..::|.|||.:||   :.:|:.:  |:|.||..: ...|::|.|.||.
Zfish   282 EITHCGQMK---RKYRVCNVTRRPASHQTFPLQQENGQTIECTVAQYFKDKYKLVLRYPHLPCLQ 343

  Fly   702 VGSSIKSILLPIELCSIEEGQALNRKDGATQVANMIKYAATSTNVRKRKIMNLLQYFQHNLDPTI 766
            ||...|...||:|:|:|..||...:|....|.:.||:..|.|...|:.:|..|::....|.||.:
Zfish   344 VGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQTSTMIRATARSAPDRQDEISKLMRSANFNTDPYV 408

  Fly   767 SRFGIRIANDFIVVSTRVLSPPQVEY---------------------------HSKRFTMVKNGS 804
            ..||:.:.:|...|:.|||..|.:.|                           .:|.......|.
Zfish   409 REFGVMVRDDMTEVNGRVLQAPSILYGGRVRISSAQLSIWLNPCLIWSCLWLFQNKAIATPVQGV 473

  Fly   805 WRMDGMKF---LEPKPKAHKCAVLYCDPRSGRKMNYTQLNDFGNLIISQGKAVNISLDSDVTYRP 866
            |.|...:|   :|.|..|..|..    |:  |:.....|..|.:.:....:...:.:.....:..
Zfish   474 WDMRNKQFHTGIEIKVWAIACFA----PQ--RQCTELLLKAFTDQLRKISRDAGMPIQGQPCFCK 532

  Fly   867 FTDDERSLDTIFADLKRSQH--DLAIVIIPQFRISYDTIKQKAELQHGILTQCIKQFTVERKCNN 929
            :.....|::.:|..||.:..  .|.:||:|.....|..:|:..:...|:.|||::...|: |...
Zfish   533 YAQGADSVEPMFKHLKYTYQGLQLVVVILPGKTPVYAEVKRVGDTVLGMATQCVQVKNVQ-KTTP 596

  Fly   930 QTIGNILLKINSKLNGINHKIKDDPR-LPMMKNTMYIGADVTHPSPDQREIPSVVGVAASHDPYG 993
            ||:.|:.||||.||.|:|:.:....| |...:..:::|||||||.....:.||:..|..|.|.:.
Zfish   597 QTLSNLCLKINVKLGGVNNILLPQGRPLVFQQPVIFLGADVTHPPAGDGKKPSIAAVVGSMDAHP 661

  Fly   994 ASYNMQYRLQRGALEEIEDMFSITLEHL-RVYKEYRNAYPDHIIYYRDGVSDGQFPKIKNEELRC 1057
            :.|....|:|:...:.|:|:.::..|.| :.||..| ..|..|||||||:|:|||.::...||..
Zfish   662 SRYCATVRVQQHRQDIIQDLATMVRELLIQFYKSTR-FKPTRIIYYRDGISEGQFNQVLQHELLA 725

  Fly  1058 IKQACDKV--GCKPKICCVIVVKRHHTRFFPSGDVTTSNKFNNVDPGTVVDRTIVHPNEMQFFMV 1120
            |::||.|:  ..:|.|..|:|.||||||.|.........|..|:..||.||..|.||.|..|::.
Zfish   726 IREACIKLEKDYQPGITFVVVQKRHHTRLFCMDRNERVGKSGNIPAGTTVDTKITHPFEFDFYLC 790

  Fly  1121 SHQAIQGTAKPTRYNVIENTGNLDIDLLQQLTYNLCHMFPRCNRSVSYPAPAYLAHLVAARGRVY 1185
            ||..||||::|:.|:|:.:..:...|.||.|||.|||.:.||.||||.|||||.|||||.|.|.:
Zfish   791 SHAGIQGTSRPSHYHVLWDDNHFTSDELQVLTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARYH 855

  Fly  1186 L 1186
            |
Zfish   856 L 856

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AGO2NP_730054.1 PLN03202 411..1180 CDD:215631 258/828 (31%)
ArgoN 411..543 CDD:293095 36/138 (26%)
ArgoL1 554..601 CDD:285861 18/52 (35%)
PAZ 605..719 CDD:239207 40/123 (33%)
Piwi_ago-like 764..1186 CDD:240015 150/458 (33%)
ago2XP_009292643.1 PLN03202 26..897 CDD:215631 268/880 (30%)
ArgoN 42..180 CDD:293095 36/157 (23%)
ArgoL1 191..240 CDD:285861 19/54 (35%)
PAZ_argonaute_like 241..361 CDD:239212 40/124 (32%)
Piwi_ago-like 406..856 CDD:240015 150/458 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1041
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR22891
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.