DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AGO2 and piwi

Sequence 1:NP_730054.1 Gene:AGO2 FlyBaseID:FBgn0087035 Length:1217 Species:Drosophila melanogaster
Sequence 2:NP_001285825.1 Gene:piwi FlyBaseID:FBgn0004872 Length:843 Species:Drosophila melanogaster

Alignment Length:937 Identity:200/938 (21%)
Similarity:358/938 (38%) Gaps:200/938 (21%)


  Fly   340 EGGYQQRPSGQQQGGHQQGR---------QGQEGGYQQRPP---GQQPNQTQSQGQYQSRGPPQQ 392
            :|..::||..:......:|.         :|...|..:..|   ..:..:...:...:..||.::
  Fly     5 QGRGRRRPLNEDDSSTSRGSGDGPRVKVFRGSSSGDPRADPRIEASRERRALEEAPRREGGPTER 69

  Fly   393 QQAAPLP-------LPPQPAGSI-KRGTIGKPGQVGINYLDLDLSKMPSVAYHYDVKIMP--ERP 447
            :     |       |..:||..: |:||.|.|..:..|:..|. :|......||.|:..|  |.|
  Fly    70 K-----PWGDQYDYLNTRPAELVSKKGTDGVPVMLQTNFFRLK-TKPEWRIVHYHVEFEPSIENP 128

  Fly   448 KKFYRQAFEQFRVDQLGGAVLAYDGKASCYSVDKLPLNSQNPEVTV-TDRNGRTLRYTIEIKETG 511
            :  .|........:.||...| :|| ...::..|.     ..|:|| :.::...:.|.|.||..|
  Fly   129 R--VRMGVLSNHANLLGSGYL-FDG-LQLFTTRKF-----EQEITVLSGKSKLDIEYKISIKFVG 184

  Fly   512 DSTIDLKSLTTYMNDRIFDKPMRAMQCVEVVLASPCHNKAIR-VGRSFFKMSDPNNRHELDD--- 572
                           .|.....|.:|.:.::|........:. |||:.|   ||..:.|:.:   
  Fly   185 ---------------FISCAEPRFLQVLNLILRRSMKGLNLELVGRNLF---DPRAKIEIREFKM 231

  Fly   573 ----GYEALVGLYQAFMLGDRPFLNVDISHKSFPISMPMIEYLERFSLKAKINNTTNLDYSRRFL 633
                |||..:..::..:|     |..:|:||     :...|.:.....:...|...:.|..|   
  Fly   232 ELWPGYETSIRQHEKDIL-----LGTEITHK-----VMRTETIYDIMRRCSHNPARHQDEVR--- 283

  Fly   634 EPFLRGINV----VYTPPQSFQSAPRVYRVNGLSRAPASSETFEHDGKKVTIASYF--------H 686
                  :||    |.|...:     |.||:|.:........||...|:.::...|:        .
  Fly   284 ------VNVLDLIVLTDYNN-----RTYRINDVDFGQTPKSTFSCKGRDISFVEYYLTKYNIRIR 337

  Fly   687 SRNYPLKFPQLH--CLNVGSSIKSILLPIELCSIEEGQALNRKDGATQVANMIKYAATSTNVRKR 749
            ..|.||...:..  .|...:|...:|:| |||.:....|..|.:     ..:::..::.|.:..:
  Fly   338 DHNQPLLISKNRDKALKTNASELVVLIP-ELCRVTGLNAEMRSN-----FQLMRAMSSYTRMNPK 396

  Fly   750 KIMNLLQYFQHNLDPT------ISRFGIRIANDFIVVSTRVLSPPQVEYHSKRFTMVKNGSWR-- 806
            :..:.|:.|.|.|..|      :..:.:.:..:...|..|::....:.:|:.:....:|..|:  
  Fly   397 QRTDRLRAFNHRLQNTPESVKVLRDWNMELDKNVTEVQGRIIGQQNIVFHNGKVPAGENADWQRH 461

  Fly   807 -------------MDGMKFLEPKPKAHKCAVLYCDPRSGRKMNYTQLNDFGNLIISQGKAVNISL 858
                         :|....:.|:..:|:...|.       ...|...:..|..|.|..:.: |..
  Fly   462 FRDQRMLTTPSDGLDRWAVIAPQRNSHELRTLL-------DSLYRAASGMGLRIRSPQEFI-IYD 518

  Fly   859 DSDVTYRPFTDDERSLDTIFADLKRSQHDLAIVIIPQFRIS-YDTIKQKAELQHGILTQCIKQFT 922
            |...||      .|::|    |..||...|.:.::|..... |.:||::..:...:.||.:...|
  Fly   519 DRTGTY------VRAMD----DCVRSDPKLILCLVPNDNAERYSSIKKRGYVDRAVPTQVVTLKT 573

  Fly   923 VERKCNNQTIGNILLKINSKLNGINHKIKDDPRLPMMKNTMYIGADVTHPSPDQREIPSVVGVAA 987
            .:.:........|.:::|.||......|:    || :...|.||.|:...:.|::.         
  Fly   574 TKNRSLMSIATKIAIQLNCKLGYTPWMIE----LP-LSGLMTIGFDIAKSTRDRKR--------- 624

  Fly   988 SHDPYG---ASYNMQYR-------LQRGALEEIED-MFSITLEHLRVYKEYRNAYPDHIIYYRDG 1041
               .||   ||.::|..       .:..|.:.:.: ::.:..:.||.|:......|..|::||||
  Fly   625 ---AYGALIASMDLQQNSTYFSTVTECSAFDVLANTLWPMIAKALRQYQHEHRKLPSRIVFYRDG 686

  Fly  1042 VSDGQFPKIKNEELRCIKQACDKVGCK--------PKICCVIVVKRHHTRFFPSGDVTTSNKFNN 1098
            ||.|...::...|   :|...:|:..:        |::..::|.:..:||||.:|        .|
  Fly   687 VSSGSLKQLFEFE---VKDIIEKLKTEYARVQLSPPQLAYIVVTRSMNTRFFLNG--------QN 740

  Fly  1099 VDPGTVVDRTIVHPNEMQFFMVSHQAIQGTAKPTRYNVIENTGNLDIDLLQQLTYNLCHMFPRCN 1163
            ..|||:||..|..|....|::||.|..|||..||.|||:.::..|..:.:|:|||.:||::...:
  Fly   741 PPPGTIVDDVITLPERYDFYLVSQQVRQGTVSPTSYNVLYSSMGLSPEKMQKLTYKMCHLYYNWS 805

  Fly  1164 RSVSYPAPAYLAHLVAARGRVYLTGTN 1190
            .:...||....|..:|.     |.|||
  Fly   806 GTTRVPAVCQYAKKLAT-----LVGTN 827

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AGO2NP_730054.1 PLN03202 411..1180 CDD:215631 182/835 (22%)
ArgoN 411..543 CDD:293095 31/135 (23%)
ArgoL1 554..601 CDD:285861 15/54 (28%)
PAZ 605..719 CDD:239207 26/128 (20%)
Piwi_ago-like 764..1186 CDD:240015 102/463 (22%)
piwiNP_001285825.1 ArgoN 91..201 CDD:293095 31/135 (23%)
PAZ 262..396 CDD:198017 29/154 (19%)
Piwi_piwi-like_Euk 382..826 CDD:240016 109/495 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR22891
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.