DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AGO2 and Ago1

Sequence 1:NP_730054.1 Gene:AGO2 FlyBaseID:FBgn0087035 Length:1217 Species:Drosophila melanogaster
Sequence 2:NP_001304110.1 Gene:Ago1 RGDID:1304619 Length:895 Species:Rattus norvegicus

Alignment Length:838 Identity:278/839 (33%)
Similarity:416/839 (50%) Gaps:77/839 (9%)


  Fly   389 PPQQQ--QAAPLPLPPQPAGSIKRGTIGKPGQVGINYLDLDLSKMPSVAYHYDVKIMPER-PKKF 450
            ||.||  ||     |.:|.    .||:|||.::..||.::|:.|:.  .|||:|.|.|:: |::.
  Rat    15 PPLQQVFQA-----PRRPG----IGTVGKPIKLLANYFEVDIPKID--VYHYEVDIKPDKCPRRV 68

  Fly   451 YRQAFE----QFRVDQLGGAVLAYDGKASCYSVDKLPLNSQNPEVTVT-DRNGRTLRYTIEIKET 510
            .|:..|    .|:....|.....||||.:.|:|..||:.::..:..|| ...|:...:.:.||..
  Rat    69 NREVVEYMVQHFKPQIFGDRKPVYDGKKNIYTVTALPIGNERVDFEVTIPGEGKDRIFKVSIKWL 133

  Fly   511 GDSTIDLKSLTTYMNDRIFDKPMRAMQCVEVVLASPCHNKAIRVGRSFFKMSDPNN-RHELDDGY 574
              :.:..:.|...:.......|:.::|.::|.:......:...||||||  |.|.. .|.|..|.
  Rat   134 --AIVSWRMLHEALVSGQIPVPLESVQALDVAMRHLASMRYTPVGRSFF--SPPEGYYHPLGGGR 194

  Fly   575 EALVGLYQAFMLGDRP-----FLNVDISHKSFPISMPMIEYLERFSLKAKINNTTNLDYSR---- 630
            |...|.:|:.    ||     .||:|:|..:|..:.|:||::      .::.:..|:|...    
  Rat   195 EVWFGFHQSV----RPAMWKMMLNIDVSATAFYKAQPVIEFM------CEVLDIRNIDEQPKPLT 249

  Fly   631 -----RFLEPFLRGINVVYTPPQSFQSAPRVYRVNGLSRAPASSETFE---HDGKKV--TIASYF 685
                 ||.:. ::|:.|..|.....:   |.|||..::|.|||.:||.   ..|:.|  |:|.||
  Rat   250 DSQRVRFTKE-IKGLKVEVTHCGQMK---RKYRVCNVTRRPASHQTFPLQLESGQTVECTVAQYF 310

  Fly   686 HSR-NYPLKFPQLHCLNVGSSIKSILLPIELCSIEEGQALNRKDGATQVANMIKYAATSTNVRKR 749
            ..: |..||:|.|.||.||...|...||:|:|:|..||...:|....|.:.|||..|.|...|:.
  Rat   311 KQKYNLQLKYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQTSTMIKATARSAPDRQE 375

  Fly   750 KIMNLLQYFQHNLDPTISRFGIRIANDFIVVSTRVLSPPQVEY--HSKRFTMVKNGSWRMDGMKF 812
            :|..|::...:||||.|..|||::.:|...|:.|||..|.::|  .::.......|.|.|.|.:|
  Rat   376 EISRLMKNASYNLDPYIQEFGIKVKDDMTEVTGRVLPAPILQYGGRNRAIATPNQGVWDMRGKQF 440

  Fly   813 ---LEPKPKAHKCAVLYCDPRSGRKMNYTQLNDFGNLIISQGKAVNISLDSDVTYRPFTDDERSL 874
               :|.|..|..|..    |:  ::.....|.:|.:.:....|...:.:.....:..:.....|:
  Rat   441 YNGIEIKVWAIACFA----PQ--KQCREEVLKNFTDQLRKISKDAGMPIQGQPCFCKYAQGADSV 499

  Fly   875 DTIFADLKR--SQHDLAIVIIPQFRISYDTIKQKAELQHGILTQCIKQFTVERKCNNQTIGNILL 937
            :.:|..||.  |...|.|||:|.....|..:|:..:...|:.|||::...|. |.:.||:.|:.|
  Rat   500 EPMFRHLKNTYSGLQLIIVILPGKTPVYAEVKRVGDTLLGMATQCVQVKNVV-KTSPQTLSNLCL 563

  Fly   938 KINSKLNGINHKIKDDPRLPMMKN-TMYIGADVTHPSPDQREIPSVVGVAASHDPYGASYNMQYR 1001
            |||.||.|||:.:....|..:.:. .:::|||||||.....:.||:..|..|.|.:.:.|....|
  Rat   564 KINVKLGGINNILVPHQRSAVFQQPVIFLGADVTHPPAGDGKKPSITAVVGSMDAHPSRYCATVR 628

  Fly  1002 LQRGALEEIEDMFSITLEHL-RVYKEYRNAYPDHIIYYRDGVSDGQFPKIKNEELRCIKQACDKV 1065
            :||...|.|||:..:..|.| :.||..| ..|..||:|||||.:||.|:|.:.||..|:.||.|:
  Rat   629 VQRPRQEIIEDLSYMVRELLIQFYKSTR-FKPTRIIFYRDGVPEGQLPQILHYELLAIRDACIKL 692

  Fly  1066 --GCKPKICCVIVVKRHHTRFFPSGDVTTSNKFNNVDPGTVVDRTIVHPNEMQFFMVSHQAIQGT 1128
              ..:|.|..::|.||||||.|.:.......|..|:..||.||..|.||.|..|::.||..||||
  Rat   693 ERDYQPGITYIVVQKRHHTRLFCADKNERIGKSGNIPAGTTVDTNITHPFEFDFYLCSHAGIQGT 757

  Fly  1129 AKPTRYNVIENTGNLDIDLLQQLTYNLCHMFPRCNRSVSYPAPAYLAHLVAARGRVYL 1186
            ::|:.|.|:.:......|.||.|||.|||.:.||.||||.|||||.|.|||.|.|.:|
  Rat   758 SRPSHYYVLWDDNRFTADELQILTYQLCHTYVRCTRSVSIPAPAYYARLVAFRARYHL 815

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AGO2NP_730054.1 PLN03202 411..1180 CDD:215631 267/807 (33%)
ArgoN 411..543 CDD:293095 37/138 (27%)
ArgoL1 554..601 CDD:285861 20/53 (38%)
PAZ 605..719 CDD:239207 41/129 (32%)
Piwi_ago-like 764..1186 CDD:240015 155/433 (36%)
Ago1NP_001304110.1 PLN03202 26..856 CDD:215631 271/823 (33%)
ArgoN 26..164 CDD:293095 38/146 (26%)
ArgoL1 175..224 CDD:285861 21/55 (38%)
PAZ_argonaute_like 225..345 CDD:239212 41/130 (32%)
Piwi_ago-like 390..815 CDD:240015 155/433 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR22891
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.