DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AGO2 and ago1

Sequence 1:NP_730054.1 Gene:AGO2 FlyBaseID:FBgn0087035 Length:1217 Species:Drosophila melanogaster
Sequence 2:NP_587782.1 Gene:ago1 PomBaseID:SPCC736.11 Length:834 Species:Schizosaccharomyces pombe

Alignment Length:853 Identity:231/854 (27%)
Similarity:389/854 (46%) Gaps:106/854 (12%)


  Fly   411 GTIGKPGQVGINYLDLDLSKMPSVA---YHYDVKIMPERPKKFYRQAFEQFRVDQLGGAV---LA 469
            |.:||...:..|:  ..:..:|:..   ||..|......|:|..:..:....|.|..|:.   ..
pombe    16 GGLGKQITLKANF--FQIISLPNETINQYHVIVGDGSRVPRKQSQLIWNSKEVKQYFGSSWMNSV 78

  Fly   470 YDGKASCYSVDKLPLNSQNPEVTV-TDRNGRTLRYTIEIKETGDSTIDLKSLTTYMNDRIFDKP- 532
            |||::.|:|  |..:.....:|.: ::.:.|.:.::|:    ..|.|:|.:|:.::|.:....| 
pombe    79 YDGRSMCWS--KGDIADGTIKVNIGSESHPREIEFSIQ----KSSKINLHTLSQFVNSKYSSDPQ 137

  Fly   533 -MRAMQCVEVVLASPCHNKAIRVGRSFFKMSDPNNRHELDDGYEALVGLYQAFMLGDRP-----F 591
             :.::..::::|.............|||   ...|...|..|.||..|.||:.    ||     .
pombe   138 VLSSIMFLDLLLKKKPSETLFGFMHSFF---TGENGVSLGGGVEAWKGFYQSI----RPNQGFMS 195

  Fly   592 LNVDISHKSFPISMPMIEYLERFSLKAKINNTTNLDYSR-----RFLEPFLRGINVVYTPPQSFQ 651
            :|||||..:|..:..:::.|..::..:.:.:.|..|..|     |||:...:..|.|.|     .
pombe   196 VNVDISSSAFWRNDSLLQILMEYTDCSNVRDLTRFDLKRLSRKFRFLKVTCQHRNNVGT-----D 255

  Fly   652 SAPRVYRVNGLSRAPASSETF----EHDGKKVTIASYF-HSRNYPLKFPQLHCLNVGSSIKSILL 711
            .|.|||.:.|.|...||...|    ..:.:|:::|.|| .:.|..|::|.|.|:.|.:   ..:|
pombe   256 LANRVYSIEGFSSKSASDSFFVRRLNGEEQKISVAEYFLENHNVRLQYPNLPCILVKN---GAML 317

  Fly   712 PIELCSIEEGQALNRKDGATQVANMIKYAATSTNVRKRKIMNLLQYFQHNLDPTISRFGIRIAND 776
            |||.|.:.:||....|..:.|.||||::|......|.::|.:.:.....:.||.::::|::|...
pombe   318 PIEFCFVVKGQRYTAKLNSDQTANMIRFAVQRPFERVQQIDDFVHQMDWDTDPYLTQYGMKIQKK 382

  Fly   777 FIVVSTRVLSPPQVEYHSKRFTMVKNGSWRMDGMKFLEPKPKA--HKCAVLYCDPRSGRKMNYTQ 839
            .:.|..|||..|.:.|.........:|.|.:.|.:||:| |:|  ...||: |. .|.|::....
pombe   383 MLEVPARVLETPSIRYGGDCIERPVSGRWNLRGKRFLDP-PRAPIRSWAVM-CF-TSTRRLPMRG 444

  Fly   840 LNDFGNLIISQGKAVNISLDSDVTYRPFTDDERSLDTIFADLKRSQHDLAIVII----------P 894
            :.:|....:....::.|:.   |..:|        ..::||::.|..:|.|.:.          |
pombe   445 IENFLQTYVQTLTSLGINF---VMKKP--------PVLYADIRGSVEELCITLYKKAEQVGNAPP 498

  Fly   895 QFRI---------SYDTIKQKAELQHGILTQC-IKQFTVERKCNNQTIGNILLKINSKLNGINHK 949
            .:..         .|.:||:......|:.:|| |.:..::.|  .|...|:.:|||.|:.|||..
pombe   499 DYLFFILDKNSPEPYGSIKRVCNTMLGVPSQCAISKHILQSK--PQYCANLGMKINVKVGGINCS 561

  Fly   950 I--KDDP--RLPMMKNTMYIGADVTHPSPDQREIPSVVGVAASHDPYGASYNMQYRLQRGALEEI 1010
            :  |.:|  .:|    |:.:|.||.||......: |:..:.||.|..|..|....|.|....|.|
pombe   562 LIPKSNPLGNVP----TLILGGDVYHPGVGATGV-SIASIVASVDLNGCKYTAVSRSQPRHQEVI 621

  Fly  1011 EDMFSITLEHLRVYKEYRNAYPDHIIYYRDGVSDGQFPKIKNEELRCIKQACDKVGCK--PKICC 1073
            |.|..|.:..|:.::......|..|||:|||.|:|||..:.|:||..||:||..:..|  |||..
pombe   622 EGMKDIVVYLLQGFRAMTKQQPQRIIYFRDGTSEGQFLSVINDELSQIKEACHSLSPKYNPKILV 686

  Fly  1074 VIVVKRHHTRFF----PSGDVTTSNKFNNVDPGTVVDRTIVHPNEMQFFMVSHQAIQGTAKPTRY 1134
            ....||||.|||    ..||     :..|..|||::::.:.||.:..|:::||.::||.:.|..|
pombe   687 CTTQKRHHARFFIKNKSDGD-----RNGNPLPGTIIEKHVTHPYQYDFYLISHPSLQGVSVPVHY 746

  Fly  1135 NVIENTGNLDIDLLQQLTYNLCHMFPRCNRSVSYPAPAYLAHLVAARGRVY-LTGTNRFLDLKKE 1198
            .|:.:...:..|..|.|.||||:::.|...:||...|.|.||||:...|.. :|..:.|::..:.
pombe   747 TVLHDEIQMPPDQFQTLCYNLCYVYARATSAVSLVPPVYYAHLVSNLARYQDVTADDTFVETSEA 811

  Fly  1199 YAKRTIVP 1206
            ...:.:.|
pombe   812 SMDQEVKP 819

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AGO2NP_730054.1 PLN03202 411..1180 CDD:215631 227/825 (28%)
ArgoN 411..543 CDD:293095 28/141 (20%)
ArgoL1 554..601 CDD:285861 18/52 (35%)
PAZ 605..719 CDD:239207 34/124 (27%)
Piwi_ago-like 764..1186 CDD:240015 134/455 (29%)
ago1NP_587782.1 PLN03202 4..833 CDD:215631 231/854 (27%)
ArgoN 12..149 CDD:293095 28/141 (20%)
ArgoL1 163..207 CDD:285861 19/51 (37%)
PAZ_argonaute_like 210..325 CDD:239212 34/123 (28%)
Piwi_ago-like 370..796 CDD:240015 134/452 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR22891
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.