DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AGO2 and AGO3

Sequence 1:NP_730054.1 Gene:AGO2 FlyBaseID:FBgn0087035 Length:1217 Species:Drosophila melanogaster
Sequence 2:NP_079128.2 Gene:AGO3 HGNCID:18421 Length:860 Species:Homo sapiens

Alignment Length:846 Identity:272/847 (32%)
Similarity:415/847 (49%) Gaps:77/847 (9%)


  Fly   386 SRGPPQQQQAAPLPLPPQPAGSIKRGTIGKPGQVGINYLDLDLSKMPSVAYHYDVKIMPER-PKK 449
            |.||...|   ||.:.|:..|   .||:|||.::..|...:::.|:.  .|.|:|.|.|:: |::
Human     5 SAGPAGAQ---PLLMVPRRPG---YGTMGKPIKLLANCFQVEIPKID--VYLYEVDIKPDKCPRR 61

  Fly   450 FYRQA----FEQFRVDQLGGAVLAYDGKASCYSVDKLPL--NSQNPEVTVTDRNGRTLRYTIEIK 508
            ..|:.    .:.|:|...|.....||||.|.|:.:.||:  ...:.:||:....|:...:.:.||
Human    62 VNREVVDSMVQHFKVTIFGDRRPVYDGKRSLYTANPLPVATTGVDLDVTLPGEGGKDRPFKVSIK 126

  Fly   509 ETGDSTIDLKSLTTYMNDRI------FDKPM--RAMQCVEVVLASPCHNKAIRVGRSFFKMSDPN 565
            ..  |.:....|...:..|.      .|||:  ..:..|:|||......|...||||||...:..
Human   127 FV--SRVSWHLLHEVLTGRTLPEPLELDKPISTNPVHAVDVVLRHLPSMKYTPVGRSFFSAPEGY 189

  Fly   566 NRHELDDGYEALVGLYQAFMLGDRP-----FLNVDISHKSFPISMPMIEYLERFSLKAKINNTTN 625
            : |.|..|.|...|.:|:.    ||     .||:|:|..:|..:.|:|:::      .::.:..|
Human   190 D-HPLGGGREVWFGFHQSV----RPAMWKMMLNIDVSATAFYKAQPVIQFM------CEVLDIHN 243

  Fly   626 LDYSRRFLEPF--------LRGINVVYTPPQSFQSAPRVYRVNGLSRAPASSETFE---HDGKKV 679
            :|...|.|...        ::|:.|..|...:.:   |.|||..::|.|||.:||.   .:|:.|
Human   244 IDEQPRPLTDSHRVKFTKEIKGLKVEVTHCGTMR---RKYRVCNVTRRPASHQTFPLQLENGQTV 305

  Fly   680 --TIASYFHSR-NYPLKFPQLHCLNVGSSIKSILLPIELCSIEEGQALNRKDGATQVANMIKYAA 741
              |:|.||..: ...||:|.|.||.||...|...||:|:|:|..||...:|....|.:.|||..|
Human   306 ERTVAQYFREKYTLQLKYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQTSTMIKATA 370

  Fly   742 TSTNVRKRKIMNLLQYFQHNLDPTISRFGIRIANDFIVVSTRVLSPPQVEYHSKRFTMV--KNGS 804
            .|...|:.:|..|::...:..||.:..|..::.::...|:.|||..|.::|..:..|:.  .:|.
Human   371 RSAPDRQEEISRLVRSANYETDPFVQEFQFKVRDEMAHVTGRVLPAPMLQYGGRNRTVATPSHGV 435

  Fly   805 WRMDGMKF---LEPKPKAHKCAVLYCDPRSGRKMNYTQLNDFGNLIISQGKAVNISLDSDVTYRP 866
            |.|.|.:|   :|.|..|..|..      :.|:.....|..|.:.:....|...:.:.....:..
Human   436 WDMRGKQFHTGVEIKMWAIACFA------TQRQCREEILKGFTDQLRKISKDAGMPIQGQPCFCK 494

  Fly   867 FTDDERSLDTIFADLKR--SQHDLAIVIIPQFRISYDTIKQKAELQHGILTQCIKQFTVERKCNN 929
            :.....|::.:|..||.  |...|.|||:|.....|..:|:..:...|:.|||::...| .|.:.
Human   495 YAQGADSVEPMFRHLKNTYSGLQLIIVILPGKTPVYAEVKRVGDTLLGMATQCVQVKNV-IKTSP 558

  Fly   930 QTIGNILLKINSKLNGINHKIKDDPRLPMMKN-TMYIGADVTHPSPDQREIPSVVGVAASHDPYG 993
            ||:.|:.||||.||.|||:.:....|..:.:. .:::|||||||.....:.||:..|..|.|.:.
Human   559 QTLSNLCLKINVKLGGINNILVPHQRPSVFQQPVIFLGADVTHPPAGDGKKPSIAAVVGSMDAHP 623

  Fly   994 ASYNMQYRLQRGALEEIEDMFSITLEHL-RVYKEYRNAYPDHIIYYRDGVSDGQFPKIKNEELRC 1057
            :.|....|:||...|.|:|:.|:..|.| :.||..| ..|..||:||||||:|||.::...||..
Human   624 SRYCATVRVQRPRQEIIQDLASMVRELLIQFYKSTR-FKPTRIIFYRDGVSEGQFRQVLYYELLA 687

  Fly  1058 IKQACDKV--GCKPKICCVIVVKRHHTRFFPSGDVTTSNKFNNVDPGTVVDRTIVHPNEMQFFMV 1120
            |::||..:  ..:|.|..::|.||||||.|.:.......:..|:..||.||..|.||.|..|::.
Human   688 IREACISLEKDYQPGITYIVVQKRHHTRLFCADRTERVGRSGNIPAGTTVDTDITHPYEFDFYLC 752

  Fly  1121 SHQAIQGTAKPTRYNVIENTGNLDIDLLQQLTYNLCHMFPRCNRSVSYPAPAYLAHLVAARGRVY 1185
            ||..||||::|:.|:|:.:......|.||.|||.|||.:.||.||||.|||||.|||||.|.|.:
Human   753 SHAGIQGTSRPSHYHVLWDDNCFTADELQLLTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARYH 817

  Fly  1186 L 1186
            |
Human   818 L 818

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AGO2NP_730054.1 PLN03202 411..1180 CDD:215631 261/814 (32%)
ArgoN 411..543 CDD:293095 39/147 (27%)
ArgoL1 554..601 CDD:285861 18/52 (35%)
PAZ 605..719 CDD:239207 39/128 (30%)
Piwi_ago-like 764..1186 CDD:240015 151/433 (35%)
AGO3NP_079128.2 ArgoN 73..167 CDD:318646 25/96 (26%)
ArgoL1 177..227 CDD:312283 19/55 (35%)
PAZ_argonaute_like 228..348 CDD:239212 39/129 (30%)
Piwi_ago-like 393..818 CDD:240015 151/433 (35%)
Interaction with guide RNA. {ECO:0000305|PubMed:29040713} 530..567 12/38 (32%)
Interaction with guide RNA. {ECO:0000305|PubMed:29040713} 758..805 25/47 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1041
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR22891
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.