DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AGO2 and alg-1

Sequence 1:NP_730054.1 Gene:AGO2 FlyBaseID:FBgn0087035 Length:1217 Species:Drosophila melanogaster
Sequence 2:NP_001257239.1 Gene:alg-1 WormBaseID:WBGene00000105 Length:1023 Species:Caenorhabditis elegans

Alignment Length:1039 Identity:297/1040 (29%)
Similarity:451/1040 (43%) Gaps:180/1040 (17%)


  Fly   318 GGYQQRPSGQQQGGHQQGRQGQEGGYQQRPSGQQQGGHQQGRQGQEGGYQQRPP---GQQPNQTQ 379
            ||.|..| |......||..|.....:  .|||.........:.....|..|:||   .|....|.
 Worm    24 GGPQYLP-GVMNSTIQQQPQSATSSF--LPSGPISSTSTSSQVVPTSGATQQPPFPSAQAAASTA 85

  Fly   380 SQGQYQS--RGPPQQQQAAPLPLPPQPAGSIKRG--------TIGKP------------------ 416
            .|...:.  ..||.|.|... .:|.:.|||:..|        :||:|                  
 Worm    86 LQNDLEEIFNSPPTQPQTFS-DVPQRQAGSLAPGVPIGNTSVSIGEPANTLGGGLPGGAPGQLPG 149

  Fly   417 -GQVGINYLDLDLSKMPS----------------------VAYHYDVKIMPER-PKKFYRQ---- 453
             .|.||.:   ...:.|:                      ...||.|.:.|:: |::..|:    
 Worm   150 GNQSGIQF---QCPRRPNHGVEGRSILLRANHFAVRIPGGTIQHYQVDVTPDKCPRRVNREIISC 211

  Fly   454 ---AFEQFRVDQLGGAVLAYDGKASCYSVDKLPLNSQNP--EVTVTDRNGRTLRYTIEIKETGDS 513
               ||.::    .......||||.:.|:.:.||:..:..  :||:...:....::::.:|..|. 
 Worm   212 LISAFSKY----FTNIRPVYDGKRNMYTREPLPIGRERMDFDVTLPGDSAVERQFSVSLKWVGQ- 271

  Fly   514 TIDLKSLTTYMNDRIFDKPMRAMQCVEVVLASPCHNKAIRVGRSFFKMSDPN------------- 565
             :.|.:|...|..|:...|..|:|.::|:|......|...||||||....||             
 Worm   272 -VSLSTLEDAMEGRVRQVPFEAVQAMDVILRHLPSLKYTPVGRSFFSPPVPNASGVMAGSCPPQA 335

  Fly   566 ------NRH---------ELDDGYEALVGLYQAFMLGDRP-----FLNVDISHKSFPISMPMIEY 610
                  ..|         :|..|.|...|.:|:.    ||     .||:|:|..:|..|||:||:
 Worm   336 SGAVAGGAHSAGQYHAESKLGGGREVWFGFHQSV----RPSQWKMMLNIDVSATAFYRSMPVIEF 396

  Fly   611 L--------ERFSLKAKINNTTNLDYSRRFLEPFLRGINVVYTPPQSFQSAPRVYRVNGLSRAPA 667
            :        :..:.:..:::...:.:::.     :||:.:..|.....:   |.|||..::|.||
 Worm   397 IAEVLELPVQALAERRALSDAQRVKFTKE-----IRGLKIEITHCGQMR---RKYRVCNVTRRPA 453

  Fly   668 SSETFE---HDGKKV--TIASYFHSR-NYPLKFPQLHCLNVGSSIKSILLPIELCSIEEGQALNR 726
            .::||.   ..|:.:  |:|.||:.: ...||:|.|.||.||...|...||.|:|:|..||...:
 Worm   454 QTQTFPLQLETGQTIECTVAKYFYDKYRIQLKYPHLPCLQVGQEQKHTYLPPEVCNIVPGQRCIK 518

  Fly   727 KDGATQVANMIKYAATSTNVRKRKIMNLLQYFQHNLDPTISRFGIRIANDFIVVSTRVLSPPQVE 791
            |....|.:.|||..|.|...|:|:|.||::..:.:.||....|||.|......|..||||.|::.
 Worm   519 KLTDVQTSTMIKATARSAPEREREISNLVRKAEFSADPFAHEFGITINPAMTEVKGRVLSAPKLL 583

  Fly   792 YHSK-RFTMVKN-GSWRMDGMKF---LEPKPKAHKCAVLYCDPRSGRKMNYTQLND---FGNLII 848
            |..: |.|.:.| |.|.|.|.:|   ::.:..|..|..         :..:.:.||   |.|.:.
 Worm   584 YGGRTRATALPNQGVWDMRGKQFHTGIDVRVWAIACFA---------QQQHVKENDLRMFTNQLQ 639

  Fly   849 SQGKAVNISLDSDVTYRPFTDDERSLDTIFADLKR--SQHDLAIVIIPQFRISYDTIKQKAELQH 911
            .......:.:..:..:..:......::.:|..||:  |...|.:|::|.....|..:|:..:...
 Worm   640 RISNDAGMPIVGNPCFCKYAVGVEQVEPMFKYLKQNYSGIQLVVVVLPGKTPVYAEVKRVGDTVL 704

  Fly   912 GILTQCIKQFTVERKCNNQTIGNILLKINSKLNGINHKIKDDPRLPMMKN--TMYIGADVTHPSP 974
            ||.|||::.....| ...||:.|:.||:|.||.|:|..:..:.| |.:.|  .::.|.|:|||..
 Worm   705 GIATQCVQAKNAIR-TTPQTLSNLCLKMNVKLGGVNSILLPNVR-PRIFNEPVIFFGCDITHPPA 767

  Fly   975 DQREIPSVVGVAASHDPYGASYNMQYRLQRGALEEIEDMFSITLEHLRVYKEYRNA--YPDHIIY 1037
            .....||:..|..|.|.:.:.|....|:|:...|.|.|:..:..|.|..:  |||.  .|..|:.
 Worm   768 GDSRKPSIAAVVGSMDAHPSRYAATVRVQQHRQEIISDLTYMVRELLVQF--YRNTRFKPARIVV 830

  Fly  1038 YRDGVSDGQFPKIKNEELRCIKQACDKV--GCKPKICCVIVVKRHHTRFFPSGDVTTSNKFNNVD 1100
            ||||||:|||..:...|||.|::||..:  |.:|.|..:.|.||||||.|.........|..|:.
 Worm   831 YRDGVSEGQFFNVLQYELRAIREACMMLERGYQPGITFIAVQKRHHTRLFAVDKKDQVGKAYNIP 895

  Fly  1101 PGTVVDRTIVHPNEMQFFMVSHQAIQGTAKPTRYNVIENTGNLDIDLLQQLTYNLCHMFPRCNRS 1165
            |||.||..|.||.|..|::.||..||||::|:.|:|:.:..||..|.||||||.:||.:.||.||
 Worm   896 PGTTVDVGITHPTEFDFYLCSHAGIQGTSRPSHYHVLWDDNNLTADELQQLTYQMCHTYVRCTRS 960

  Fly  1166 VSYPAPAYLAHLVAARGRVYL-------------TGTNRFLDLKKEYAKRTIVPEFMKKNPMYF 1216
            ||.|||||.|||||.|.|.:|             :||:....|........:.|:  ..|.|||
 Worm   961 VSIPAPAYYAHLVAFRARYHLVDREHDSGEGSQPSGTSEDTTLSNMARAVQVHPD--ANNVMYF 1022

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AGO2NP_730054.1 PLN03202 411..1180 CDD:215631 260/891 (29%)
ArgoN 411..543 CDD:293095 35/191 (18%)
ArgoL1 554..601 CDD:285861 20/80 (25%)
PAZ 605..719 CDD:239207 35/128 (27%)
Piwi_ago-like 764..1186 CDD:240015 153/438 (35%)
alg-1NP_001257239.1 PLN03202 162..974 CDD:215631 252/843 (30%)
ArgoN 162..300 CDD:293095 28/144 (19%)
ArgoL1 311..389 CDD:285861 21/82 (26%)
PAZ_argonaute_like 390..511 CDD:239212 36/129 (28%)
Piwi_ago-like 556..981 CDD:240015 153/438 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1041
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S1910
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR22891
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.