DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AGO2 and rde-1

Sequence 1:NP_730054.1 Gene:AGO2 FlyBaseID:FBgn0087035 Length:1217 Species:Drosophila melanogaster
Sequence 2:NP_741611.1 Gene:rde-1 WormBaseID:WBGene00004323 Length:1020 Species:Caenorhabditis elegans

Alignment Length:1049 Identity:221/1050 (21%)
Similarity:382/1050 (36%) Gaps:258/1050 (25%)


  Fly   381 QGQYQSRGPPQQQQAAPLPLPPQPAGSIKRGTIGKPGQVGINYLDLDLSKMPSVAYHYDVKI--- 442
            :|.|:....|:.:..|      :|.|........|...:.:|:............|.|:||:   
 Worm    10 KGFYRHSLDPEMKWLA------RPTGKCDGKFYEKKVLLLVNWFKFSSKIYDREYYEYEVKMTKE 68

  Fly   443 -----------------MPERPKKFYRQAFEQFRVDQLGGAVLAYDGKASCYSVDKLPLNSQNPE 490
                             :|:|.|.|::....:.:..........:|.|.:.|||.:  ||:...:
 Worm    69 VLNRKPGKPFPKKTEIPIPDRAKLFWQHLRHEKKQTDFILEDYVFDEKDTVYSVCR--LNTVTSK 131

  Fly   491 VTVTDRNGRTLRYTIEIKETGDSTIDLKSLTTYM--------------NDRIFDKPMRAMQCVEV 541
            :.|::   :.::...|.|:..|  ::.|.|.|.:              |....::..|:.:.::.
 Worm   132 MLVSE---KVVKKDSEKKDEKD--LEKKILYTMILTYRKKFHLNFSRENPEKDEEANRSYKFLKN 191

  Fly   542 VLASPC---------------------HNKAIRVGRSFFKMSDPNNRH---ELDDGYEALVGLYQ 582
            |:....                     :|..:||..||   .|||...   |:....||..|:|.
 Worm   192 VMTQKVRYAPFVNEEIKVQFAKNFVYDNNSILRVPESF---HDPNRFEQSLEVAPRIEAWFGIYI 253

  Fly   583 AF--MLGDRPFLNVDISHKSF---PISMPMIEYL------------ERFSLKAKI--NNTTNLDY 628
            ..  :....|.||..|..|.|   | .|.:::||            .|..||.|:  ...|....
 Worm   254 GIKELFDGEPVLNFAIVDKLFYNAP-KMSLLDYLLLIVDPQSCNDDVRKDLKTKLMAGKMTIRQA 317

  Fly   629 SRRFLEPFLRGINV----VYTPPQS------------FQSAPRVYRVNGLSRAPASSETFEHDGK 677
            :|..:...|..:.:    |:....|            .:....||:|.|.|....:::.::    
 Worm   318 ARPRIRQLLENLKLKCAEVWDNEMSRLTERHLTFLDLCEENSLVYKVTGKSDRGRNAKKYD---- 378

  Fly   678 KVTIASYFHSRNYPLKFPQLHCLNVGSSIKSILLPIELCSIEE--GQALNRKDGATQVANMIKYA 740
             .|:...:......::||.|..:.|.|..|...:|:|...:.|  .:..||.|...| ...:|.|
 Worm   379 -TTLFKIYEENKKFIEFPHLPLVKVKSGAKEYAVPMEHLEVHEKPQRYKNRIDLVMQ-DKFLKRA 441

  Fly   741 ATSTNVRKRKIMNLLQYFQHNLDPT--ISRFGIRIANDFIVVSTRVLSPPQV---EYHSKRFTMV 800
            ....:..|...:.:|:....:.:..  :.|||:......|....:||..|.:   .....:.|.|
 Worm   442 TRKPHDYKENTLKMLKELDFSSEELNFVERFGLCSKLQMIECPGKVLKEPMLVNSVNEQIKMTPV 506

  Fly   801 KNGSWRMDGMKFLEPKPKAHKCAVLYCDPRSGRKMNYTQLNDFGNLIISQGKAVNI--SLDSDVT 863
            ..|...    |.|...|:...|..::.       :|.|.    ||..:.:...|..  .|.....
 Worm   507 IRGFQE----KQLNVVPEKELCCAVFV-------VNETA----GNPCLEENDVVKFYTELIGGCK 556

  Fly   864 YRPF---TDDERSLDTIFADLKRSQHD-----------------------------------LAI 890
            :|..   .::.|...:|..|..::::.                                   |..
 Worm   557 FRGIRIGANENRGAQSIMYDATKNEYAFYKNCTLNTGIGRFEIAATEAKNMFERLPDKEQKVLMF 621

  Fly   891 VIIPQFRI-SYDTIKQKAELQHGILTQCIKQFTVER--------KCNNQTIGNILLKINSKLNGI 946
            :||.:.:: :|..:|...:...|:..|.|...||.:        |.:.:....|.||||:||.||
 Worm   622 IIISKRQLNAYGFVKHYCDHTIGVANQHITSETVTKALASLRHEKGSKRIFYQIALKINAKLGGI 686

  Fly   947 NHKI----------KDDPRLPMMKNTMYIGADVTHPSPDQREIPSVVGVAASHDPYGASYNMQYR 1001
            |.::          ::..|...|..|||:|.|||||:.......|:..|.||.:|.|..|.....
 Worm   687 NQELDWSEIAEISPEEKERRKTMPLTMYVGIDVTHPTSYSGIDYSIAAVVASINPGGTIYRNMIV 751

  Fly  1002 LQ-------------RGALEEIEDMFSITLEHLRVYKEYR-NAYPDHIIYYRDGVSDGQFPKIKN 1052
            .|             |...:.:|..|   ::.||.:.|.. |..|.||:.|||||||.:..::.:
 Worm   752 TQEECRPGERAVAHGRERTDILEAKF---VKLLREFAENNDNRAPAHIVVYRDGVSDSEMLRVSH 813

  Fly  1053 EELRCIKQAC-------DKVGCKPKICCVIVVKRHHTRFF---------------PS-------- 1087
            :|||.:|...       |....:||...:::.|||:||..               |:        
 Worm   814 DELRSLKSEVKQFMSERDGEDPEPKYTFIVIQKRHNTRLLRRMEKDKPVVNKDLTPAETDVAVAA 878

  Fly  1088 -----GDVTTSNKFNNVDP--GTVVDRTIVHPNEMQFFMVSHQAIQGTAKPTRYNVIENTGNLDI 1145
                 .|:..|.:...|:|  ||.||:.||...:..||:.||..:.||::|..|.|:.:...:..
 Worm   879 VKQWEEDMKESKETGIVNPSSGTTVDKLIVSKYKFDFFLASHHGVLGTSRPGHYTVMYDDKGMSQ 943

  Fly  1146 DLLQQLTYNLCHMFPRCNRSVSYPAPAYLAHLVAARGR-VYLTGTNRFLDLKKEYAK---RTIVP 1206
            |.:.::||.|..:..||.:.:|.|.|.:.|||...:.: :|.|....::.   :||:   |..:.
 Worm   944 DEVYKMTYGLAFLSARCRKPISLPVPVHYAHLSCEKAKELYRTYKEHYIG---DYAQPRTRHEME 1005

  Fly  1207 EFMKKNPMY 1215
            .|::.|..|
 Worm  1006 HFLQTNVKY 1014

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AGO2NP_730054.1 PLN03202 411..1180 CDD:215631 207/979 (21%)
ArgoN 411..543 CDD:293095 27/166 (16%)
ArgoL1 554..601 CDD:285861 16/52 (31%)
PAZ 605..719 CDD:239207 26/144 (18%)
Piwi_ago-like 764..1186 CDD:240015 126/538 (23%)
rde-1NP_741611.1 PAZ_argonaute_like 280..419 CDD:239212 26/144 (18%)
Piwi_ago-like 467..982 CDD:240015 125/533 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1041
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S1910
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR22891
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.