DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AGO2 and ergo-1

Sequence 1:NP_730054.1 Gene:AGO2 FlyBaseID:FBgn0087035 Length:1217 Species:Drosophila melanogaster
Sequence 2:NP_503362.2 Gene:ergo-1 WormBaseID:WBGene00019971 Length:1121 Species:Caenorhabditis elegans

Alignment Length:1227 Identity:268/1228 (22%)
Similarity:436/1228 (36%) Gaps:357/1228 (29%)


  Fly   194 HQQGRQGQEGGYQQRPPGQQQGGHQQGRQGQEGGYQQRPSGQQQGGHQQGRQGQEGGYQQRPPGQ 258
            :..|..|..|||:.   .:....|...||      ..|.|.|.:.|:...|  ::..|..|    
 Worm     3 YNNGGGGGGGGYRN---DRDDRYHNNDRQ------NYRSSDQGRSGYNDDR--RDNRYDDR---- 52

  Fly   259 QQGGHQQGRQGQEGGYQQRPPGQQQGGHEQGRQGQEGGYQQRPSGQQQGGHQQGRQGQEGGYQQR 323
                  :|.....|.|.|.   .::|.....|:|..        |..|||         |||||:
 Worm    53 ------RGSNNDRGCYDQH---DRRGSSNDDRRGYR--------GYNQGG---------GGYQQQ 91

  Fly   324 PSGQQQGGHQQ------GRQGQEGGYQQRPSGQQQGGHQQGRQGQEGGYQ----QRPPG------ 372
            .|...:.|..|      ..:|..||....   .|.||::.|..|:.||.:    ...||      
 Worm    92 YSQDARYGSNQRNDNYGNNRGSHGGANMY---SQNGGNRGGGGGRVGGGRTAAGMSNPGDLVGGA 153

  Fly   373 QQPNQTQSQGQYQSRGPPQQQQAAPLPLPPQPAGSIKRGTIGKPGQVGINYLDLDLSKMPSVAYH 437
            .||..:.|:...:...   |:.|.      :|...::...:|:...:..|:..:.|.:.|...:.
 Worm   154 DQPIHSVSKKSLRHNA---QEFAV------RPKTMVQDKGLGQKTTLLTNHTLVQLPQEPITLHV 209

  Fly   438 YDVKIMPERPKKFYRQAFEQFRVDQLGGAVLAYDGKAS-----C--------------------- 476
            :::::.                          .:||:|     |                     
 Worm   210 FNIEVF--------------------------INGKSSNKRELCGPRFWEILKENKPTFGMPNQY 248

  Fly   477 --------YSVDKLPLNSQNPEVTVTDRNGRTLRYTIEIKETG----DSTIDLKSLTTYMNDRIF 529
                    :|.:||   .|:...|...|.....:|..:||..|    :.|:.|  |:|.: |.| 
 Worm   249 IFNDVNMMWSTNKL---RQSEGRTNNRRMNFVWKYVKQIKFGGNIEDEETMQL--LSTLI-DAI- 306

  Fly   530 DKPMRAMQCVEVVLASPCHNKAIRVGRSFFK--------------MSDPNNRHELDDGYEALVGL 580
                 |.|...:.||.|.:        :.||              :.|.:..|:|..|.:|.||:
 Worm   307 -----ATQRARLPLAPPKY--------TVFKRLTYLICEEAYEPELPDVSLCHKLRIGTDARVGV 358

  Fly   581 YQAFMLGDRPFLNV--DISHKSF--PISMPMIEYL-----------ERFSLK--AKINNTTNLDY 628
            ..|.....|..:..  |:.|..|  | :.|::..|           |.|.:|  |.:......|.
 Worm   359 SIAIRTNLRAGITACFDLGHTLFTRP-AYPLVRLLCDIIEHSVVLDEAFEMKYDAALRACNVSDE 422

  Fly   629 SRRFLEPFLRGI----------------NVVYTPPQSFQSAPRVYRVNGLSRAPASSETFEHDGK 677
            :.|.:...|..:                .|:..|..:.::..|.::..||. |||....|..||.
 Worm   423 NLRVMTQILTKMTLQLSTETGDYVGEDGEVIVRPAPTIRNPGRNFKFVGLG-APADRYYFTSDGV 486

  Fly   678 KVTIASYFHSR-NYPLKFPQLHCL------NVGSSIKSILLPIELCSIEEGQALNRKDGATQV-- 733
            ::|:|.|:..: |..|::|.|.|:      ..|:  |...:|:||.|..  ....|..|.|..  
 Worm   487 ELTVADYYLQKYNIRLRYPNLPCVLKKAPEQCGN--KHSAMPLELVSYI--VVPTRYGGFTMPDM 547

  Fly   734 -ANMIKYAATSTNVRKRKIMNLL-QYFQHNLDPTIS-------RFGIRIANDFIVVSTRVLSPPQ 789
             |:||.....:...|.:.:.::: |.....::|.:|       :..:.:..:.|.|...:|.||.
 Worm   548 RADMINKTTYTAQQRGKLLQHIIAQKSLSGIEPPVSNNDDYMKKHKLVMKREPIRVKATILPPPT 612

  Fly   790 VEYHSKRFTMVKN-GSWR----------MDGMKFLEPKPKAHKCA------------VLYCDPRS 831
            :.|....|....: |.|.          :||..|   :.|.:|.:            :|...||.
 Worm   613 LVYGDSVFHDEHHIGEWEAVTHDPPRQVLDGAVF---RRKLYKSSEQPLMKRLMGSILLIQSPRQ 674

  Fly   832 GRKMNYTQ---------LNDFGNLIISQGKAVNISLDSDVTYRPFTDDERSLDTIFADLKRSQHD 887
            .|..:|.|         :.|.|..::                  :.|:.:....|..:|:.:|:.
 Worm   675 CRDFDYNQQGYHAIMRAIEDSGQPVL------------------WADENKHSAVIQGELQFNQNQ 721

  Fly   888 LAIVIIPQFRIS---------------------------------------YDTIKQKAELQHGI 913
            ..|.:|.||..:                                       |:.:|..|:.::||
 Worm   722 HGIEVIEQFLQNIKSTIGEYERDGEVIVPIVFAVFQARATVYSGNNNEYNDYNVLKYLADNKYGI 786

  Fly   914 LTQCI------------KQFTVERKCNNQTIGNILLKINSKLNGINHK---IKDDPRLPMMKNTM 963
            .||.|            |...:.|....:.:|.:.........|..||   |..||..|    |:
 Worm   787 HTQGILEKSLGVVGPSPKNCALTRLMVEKVLGKVGTTHRKLERGGAHKTWTIFTDPAKP----TL 847

  Fly   964 YIGADVTHPSPDQREIPSVV------GVAASHDPYGASYNMQYRLQRGALEEIEDMFSITLEHLR 1022
            .:|.||:|||...||..:|:      .|..:.|.....:....|:|...:|.:.|......|.:.
 Worm   848 VLGIDVSHPSTRDRETGNVLQKMSAATVVGNIDLDVTEFRASSRIQDTGVECLIDFSKEIDERIG 912

  Fly  1023 VYKEYRNAYPDHIIYYRDGVSDGQFPKIKNEELRCIKQACDKV--GCKPKICCVIVVKRHHTRFF 1085
            .:.::....|.||:.||||:|:|.|.|...||..||::.|.|:  ..:|.|..::|.|||||:||
 Worm   913 EFIDHTGKRPAHIVVYRDGLSEGDFQKYLFEERVCIEERCLKIDTSFQPSITYIVVTKRHHTQFF 977

  Fly  1086 ---PSGDVTTSNKFNNVDPGTVVDRTIVHPNEMQFFMVSHQAIQGTAKPTRYNVIEN--TGNLDI 1145
               ||....:..  .||.|||:::..:.......||:.:....:|..:||.|.|:.:  ||..|.
 Worm   978 LEDPSQGYESQG--YNVLPGTLIEDAVTTNKYYDFFLSTQIGNEGCFRPTHYYVLHDTWTGKPDS 1040

  Fly  1146 ---DLLQQLTYNLCHMFPRCNRSVSYPAPAYLAHLVAARGRVYLTGTNRFLDLKKEY 1199
               .:...||||.|    |...:|:.|||...|||.|.|.:..|.|.|.:..:...|
 Worm  1041 FWPTVTHALTYNFC----RSTTTVALPAPVLYAHLAAKRAKETLDGINTYKSVNNIY 1093

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AGO2NP_730054.1 PLN03202 411..1180 CDD:215631 211/974 (22%)
ArgoN 411..543 CDD:293095 26/170 (15%)
ArgoL1 554..601 CDD:285861 13/63 (21%)
PAZ 605..719 CDD:239207 34/150 (23%)
Piwi_ago-like 764..1186 CDD:240015 126/531 (24%)
ergo-1NP_503362.2 PAZ 421..557 CDD:198017 34/141 (24%)
Piwi_ago-like 588..1080 CDD:240015 124/523 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1041
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S1910
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR22891
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.