DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AGO2 and alg-3

Sequence 1:NP_730054.1 Gene:AGO2 FlyBaseID:FBgn0087035 Length:1217 Species:Drosophila melanogaster
Sequence 2:NP_502217.1 Gene:alg-3 WormBaseID:WBGene00011910 Length:1035 Species:Caenorhabditis elegans

Alignment Length:970 Identity:259/971 (27%)
Similarity:411/971 (42%) Gaps:194/971 (20%)


  Fly   369 RPPGQQPNQTQSQGQYQSRGPPQQQQA-------APLPLPPQPAGSIK------------RGTIG 414
            ||...|.:...|.|   |..||...|.       :|..|.|.....:.            .||||
 Worm    33 RPASGQASPLSSNG---SLSPPVDDQGSVSYNSDSPRDLSPLLLSELACLNMREVVARPGLGTIG 94

  Fly   415 KPGQVGINYLDLDLS--KMPSVAYHYDV------------------KIMPERPKKFYRQAFEQFR 459
            :...|..|:..:||.  ||..|.||.:|                  |.:.:.|..|:.:      
 Worm    95 RKIPVKSNFFAVDLKNPKMVVVQYHVEVHHPGCRKLDKDEMRIIFWKAVSDHPNIFHNK------ 153

  Fly   460 VDQLGGAVLAYDGKASCYSVDKLPLNSQNPEVTV-------TDRNGRTLRYTIEIKETGDSTIDL 517
                  ..|||||....|:|.:|........|.:       .|...|| |..|.|:..|...:::
 Worm   154 ------FALAYDGAHQLYTVARLEFPDDQGSVRLDCEATLPKDNRDRT-RCAISIQNVGPVLLEM 211

  Fly   518 -KSLTTYMNDRIFDKPMRAMQCVEVVL------------------ASPCHNKAIRVGRSFFKMSD 563
             ::.|..:::|:    :..:|.::::.                  .|.|:......|::.     
 Worm   212 QRTRTNNLDERV----LTPIQILDIICRQSLTCPLLKNSANFYTWKSSCYRIPTAAGQAL----- 267

  Fly   564 PNNRHELDDGYEALVGLYQAFMLGD--RPFLNVDISHKSF-----PISMPMIEYLERFSLKAKIN 621
                 :|:.|.|...|.:.:..:..  ||.||:|::|.:|     .:...|.:.|...:.|...|
 Worm   268 -----DLEGGKEMWTGFFSSAHIASNYRPLLNIDVAHTAFYKTRITVLQFMCDVLNERTSKPNRN 327

  Fly   622 N--------------------------------------------TTNLD----------YSRRF 632
            |                                            |..:|          :..|.
 Worm   328 NPRGPGAPGGYRGGRGGARGGSYQNFGNRGPPGANVRDDFGGNGLTFTMDTLSRDTQLSSFETRI 392

  Fly   633 LEPFLRG--INVVYTPPQSFQSAPRVYRVNGLSRAPASSETF---EHDGKKV--TIASYFHSRNY 690
            ....:||  |...:.|     :|.|||:||.| :.||....|   :.:|::|  ::|.||..:..
 Worm   393 FGDSIRGMKIRATHRP-----NAIRVYKVNSL-QLPADKLMFQGIDEEGRQVVCSVADYFSEKYG 451

  Fly   691 PLKFPQLHCLNVGSSIKSILLPIELCSIEEGQALNRKDGATQVANMIKYAATSTNVRKRKIMNLL 755
            |||:|:|.||:||...::|.||:|.|.|:..|..|:|....|.:.:||.||.....|:.:|..|.
 Worm   452 PLKYPKLPCLHVGPPTRNIFLPMEHCLIDSPQKYNKKMTEKQTSAIIKAAAVDATQREDRIKQLA 516

  Fly   756 QYFQHNLDPTISRFGIRIANDFIVVSTRVLSPPQVEY--HSKRFTMV---KNGSWRMDGMKFLEP 815
            .......||.:..||:.:::..|..|.||:.||.:.:  :::....|   |:|||.||......|
 Worm   517 AQASFGTDPFLKEFGVAVSSQMIETSARVIQPPPIMFGGNNRSINPVVFPKDGSWSMDHQTLYMP 581

  Fly   816 KPKAHKCAVLYCDPRSGRKMNYTQLNDFGNLIISQGKAVNISL---DSDVTYRPFTDDERSLDTI 877
            ........:...|||     :.|.|..|...:..:..|:.::.   ...|.|....:|..:|.|.
 Worm   582 ATCRSYSMIALVDPR-----DQTSLQTFCQSLTMKATAMGMNFPRWPDLVKYGRSKEDVCTLFTE 641

  Fly   878 FADLKRSQHDL--AIVIIPQFRIS--YDTIKQKAELQHGILTQCIKQFTVERKCNNQTIGNILLK 938
            .||..|..:.:  .|:::.|.:.|  |.|:|:::::.|||::||:....|.|. ...|..||:||
 Worm   642 IADEYRVTNTVCDCIIVVLQSKNSDIYMTVKEQSDIVHGIMSQCVLMKNVSRP-TPATCANIILK 705

  Fly   939 INSKLNGINHKIKDDP---RLPMMKNTMYIGADVTHPSPDQ--REIPSVVGVAASHDPYGASYNM 998
            :|.|:.|||.:|..|.   :..:.:.||.:|.|||||:..:  ..:|||..:.|:.|....||..
 Worm   706 LNMKMGGINSRIVADQITNKYLVDQPTMVVGIDVTHPTQAEMRMNMPSVAAIVANVDLLPQSYGA 770

  Fly   999 QYRLQRGALEEIEDMFSITLEHLRVYKEYRNAYPDHIIYYRDGVSDGQFPKIKNEELRCIKQACD 1063
            ..::|:...|.:..:.....|.:..:..:....|..||.||||||:|||.::..||::.|:.||.
 Worm   771 NVKVQKKCRESVVYLLDAIRERIITFYRHTKQKPARIIVYRDGVSEGQFSEVLREEIQSIRTACL 835

  Fly  1064 KVG--CKPKICCVIVVKRHHTRFFPSGDVTTSNKFNNVDPGTVVDRTIVHPNEMQFFMVSHQAIQ 1126
            .:.  .:|.|..::|.||||.|.|.........|..||.|||.||..||.|....|::.||..:|
 Worm   836 AIAEDFRPPITYIVVQKRHHARIFCKFPNDMVGKAKNVPPGTTVDTGIVSPEGFDFYLCSHYGVQ 900

  Fly  1127 GTAKPTRYNVIENTGNLDIDLLQQLTYNLCHMFPRCNRSVSYPAPAYLAHLVAARGRVYL 1186
            ||::|.||:|:.:......|.:|.:||.:||.:.||.||||.|.|.|.|.|||.|.|.::
 Worm   901 GTSRPARYHVLLDECKFTADEIQNITYGMCHTYGRCTRSVSIPTPVYYADLVATRARCHI 960

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AGO2NP_730054.1 PLN03202 411..1180 CDD:215631 245/902 (27%)
ArgoN 411..543 CDD:293095 36/160 (23%)
ArgoL1 554..601 CDD:285861 11/49 (22%)
PAZ 605..719 CDD:239207 42/175 (24%)
Piwi_ago-like 764..1186 CDD:240015 143/441 (32%)
alg-3NP_502217.1 PLN03202 65..961 CDD:215631 250/936 (27%)
ArgoN 87..233 CDD:293095 36/163 (22%)
ArgoL1 264..304 CDD:285861 12/50 (24%)
PAZ_argonaute_like 369..479 CDD:239212 36/116 (31%)
Piwi_ago-like 525..960 CDD:240015 143/441 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1041
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR22891
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.