DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AGO2 and alg-4

Sequence 1:NP_730054.1 Gene:AGO2 FlyBaseID:FBgn0087035 Length:1217 Species:Drosophila melanogaster
Sequence 2:NP_499191.1 Gene:alg-4 WormBaseID:WBGene00006449 Length:1040 Species:Caenorhabditis elegans

Alignment Length:1055 Identity:266/1056 (25%)
Similarity:428/1056 (41%) Gaps:253/1056 (24%)


  Fly   369 RPPGQQPNQTQSQGQYQSRGPPQ--------------QQQAAPLPLPPQPAGSIKR-------GT 412
            ||...|.:...|.|   |..|||              .:..:||.|......:::.       ||
 Worm    33 RPASGQASPLTSNG---SLSPPQYADDQGSVSYNLDSPRDLSPLLLSELACLNMREVVARPGLGT 94

  Fly   413 IGKPGQVGINYLDLDLS--KMPSVAYHYDV------------------KIMPERPKKFYRQAFEQ 457
            ||:...|..|:..:||.  ||..:.||.::                  |.:.:.|..|:.:    
 Worm    95 IGRQIPVKSNFFAMDLKNPKMVVIQYHVEIHHPGCRKLDKDEMRIIFWKAVSDHPNIFHNK---- 155

  Fly   458 FRVDQLGGAVLAYDGKASCYSVDKLPLNSQNPEVTV-------TDRNGRTLRYTIEIKETGDSTI 515
                    ..|||||....|:|.:|........|.:       .|...|| |..|.|:..|...:
 Worm   156 --------FALAYDGAHQLYTVARLEFPDDQGSVRLDCEASLPKDNRDRT-RCAISIQNVGPVLL 211

  Fly   516 DL-KSLTTYMNDRIFDKPMRAMQCVEVVL------------------ASPCHNKAIRVGRSFFKM 561
            :: ::.|..:::|:    :..:|.::::.                  .|.|:......|::.   
 Worm   212 EMQRTRTNNLDERV----LTPIQILDIICRQSLTCPLLKNSANFYTWKSSCYRIPTAAGQAL--- 269

  Fly   562 SDPNNRHELDDGYEALVGLYQAFMLGD--RPFLNVDISHKSF-----PISMPMIEYLERFSLKAK 619
                   :|:.|.|...|.:.:..:..  ||.||:|::|.:|     .:...|.:.|...:.|..
 Worm   270 -------DLEGGKEMWTGFFSSAHIASNYRPLLNIDVAHTAFYKTRITVLQFMCDVLNERTSKPN 327

  Fly   620 INN-----------------------------------------------TTNLD---------- 627
            .||                                               |..:|          
 Worm   328 RNNPRGPGGPGGPGGYRGGRGGGRGGSYGNFGNRGPPGANVRDDFGGNGLTFTMDTLSRDTQLSS 392

  Fly   628 YSRRFLEPFLRG--INVVYTPPQSFQSAPRVYRVNGLSRAPASSETF---EHDGKKV--TIASYF 685
            :..|.....:||  |...:.|     :|.|||:||.| :.||....|   :.:|::|  ::|.||
 Worm   393 FETRIFGDAIRGMKIRAAHRP-----NAIRVYKVNSL-QLPADKLMFQGIDEEGRQVVCSVADYF 451

  Fly   686 HSRNYPLKFPQLHCLNVGSSIKSILLPIELCSIEEGQALNRKDGATQVANMIKYAATSTNVRKRK 750
            ..:..|||:|:|.||:||...::|.||:|.|.|:..|..|:|....|.:.:||.||.....|:.:
 Worm   452 SEKYGPLKYPKLPCLHVGPPTRNIFLPMEHCLIDSPQKYNKKMSEKQTSAIIKAAAVDATQREDR 516

  Fly   751 IMNLLQYFQHNLDPTISRFGIRIANDFIVVSTRVLSPPQVEYHSKR-----FTMVKNGSWRMDGM 810
            |..|........||.:..||:.:::..|..:.||:.||.:.:....     ....|:|||.||..
 Worm   517 IKQLAAQASFGTDPFLKEFGVAVSSQMIQTTARVIQPPPIMFGGNNRSVNPVVFPKDGSWTMDNQ 581

  Fly   811 KFLEPKPKAHKCAVLYCDPRSGRKMNYTQLNDFGNLIISQGKAVNISL---DSDVTYRPFTDDER 872
            ....|........:...|||     :.|.|..|...:..:..|:.::.   ...|.|....:|..
 Worm   582 TLYMPATCRSYSMIALVDPR-----DQTSLQTFCQSLTMKATAMGMNFPRWPDLVKYGRSKEDVC 641

  Fly   873 SLDTIFADLKRSQHDL--AIVIIPQFRIS--YDTIKQKAELQHGILTQCIKQFTVERKCNNQTIG 933
            :|.|..||..|..:.:  .|:::.|.:.|  |.|:|:::::.|||::||:....|.|. ...|..
 Worm   642 TLFTEIADEYRVTNTVCDCIIVVLQSKNSDIYMTVKEQSDIVHGIMSQCVLMKNVSRP-TPATCA 705

  Fly   934 NILLKINSKLNGINHKIKDDP---RLPMMKNTMYIGADVTHPSPDQ--REIPSVVGVAASHDPYG 993
            ||:||:|.|:.|||.:|..|.   :..:.:.||.:|.|||||:..:  ..:|||..:.|:.|...
 Worm   706 NIVLKLNMKMGGINSRIVADKITNKYLVDQPTMVVGIDVTHPTQAEMRMNMPSVAAIVANVDLLP 770

  Fly   994 ASYNMQYRLQRGALEEIEDMFSITLEHLRVYKEYRNAYPDHIIYYRDGVSDGQFPKIKNEELRCI 1058
            .||....::|:...|.:..:.....|.:..:..:....|..||.||||||:|||.::..||::.|
 Worm   771 QSYGANVKVQKKCRESVVYLLDAIRERIITFYRHTKQKPARIIVYRDGVSEGQFSEVLREEIQSI 835

  Fly  1059 KQACDKVG--CKPKICCVIVVKRHHTRFFPSGDVTTSNKFNNVDPGTVVDRTIVHPNEMQFFMVS 1121
            :.||..:.  .:|.|..::|.||||.|.|.........|..||.|||.||..||.|....|::.|
 Worm   836 RTACLAIAEDFRPPITYIVVQKRHHARIFCKYQNDMVGKAKNVPPGTTVDTGIVSPEGFDFYLCS 900

  Fly  1122 HQAIQGTAKPTRYNVIENTGNLDIDLLQQLTYNLCHMFPRCNRSVSYPAPAYLAHLVAARGRVYL 1186
            |..:|||::|.||:|:.:......|.:|.:||.:||.:.||.||||.|.|.|.|.|||.|.|.::
 Worm   901 HYGVQGTSRPARYHVLLDECKFTADEIQSITYGMCHTYGRCTRSVSIPTPVYYADLVATRARCHV 965

  Fly  1187 ----------------------------TGTNRFLDLKKEYAKR--------------------- 1202
                                        ||:.:.   ||.||..                     
 Worm   966 KRKLGLADNNDCDTNSRSSTLASLLNVRTGSGKG---KKSYAPSVDDESYSLSDATSDQILQDCV 1027

  Fly  1203 TIVPEFMKKNPMYFV 1217
            ::..:|  |:.|||:
 Worm  1028 SVATDF--KSRMYFI 1040

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AGO2NP_730054.1 PLN03202 411..1180 CDD:215631 241/905 (27%)
ArgoN 411..543 CDD:293095 34/160 (21%)
ArgoL1 554..601 CDD:285861 11/49 (22%)
PAZ 605..719 CDD:239207 42/178 (24%)
Piwi_ago-like 764..1186 CDD:240015 141/441 (32%)
alg-4NP_499191.1 PLN03202 67..959 CDD:215631 244/931 (26%)
ArgoN 89..235 CDD:293095 34/163 (21%)
ArgoL1 266..306 CDD:285861 12/50 (24%)
PAZ_argonaute_like 374..484 CDD:239212 36/116 (31%)
Piwi_ago-like 530..964 CDD:240015 141/440 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S1910
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR22891
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.