DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AGO2 and wago-4

Sequence 1:NP_730054.1 Gene:AGO2 FlyBaseID:FBgn0087035 Length:1217 Species:Drosophila melanogaster
Sequence 2:NP_496751.1 Gene:wago-4 WormBaseID:WBGene00010263 Length:965 Species:Caenorhabditis elegans

Alignment Length:997 Identity:216/998 (22%)
Similarity:366/998 (37%) Gaps:262/998 (26%)


  Fly   371 PGQQPNQTQSQGQYQSRGPPQQQQAAPLPLPPQPAGS---------IKR-------------GTI 413
            |...|..|.|........||   ...|:|:|.||..|         |||             .|.
 Worm     2 PALPPVYTPSGAPSSVHAPP---AVPPVPVPTQPLRSEYQTSNDACIKRLEELNIAPAAKLYPTP 63

  Fly   414 GKPGQVGI------NYLDLDLSKMPSVAYHYDVKIMPE----RPKKFYRQAFEQFRVDQ------ 462
            .:||:.|:      |...:::.: .|:.|.|.|.|..|    :...|.::..:.|.|.:      
 Worm    64 TEPGKCGVEAEIQTNVFGIEMHQ-DSLFYQYSVNITTELKNGKEVTFTKKGKDDFVVTERHDKCC 127

  Fly   463 ------LG---------GAVLAYDGKASCYS------------------------VDKLPLNS-- 486
                  ||         .:.|.|||::..:|                        :|...|.|  
 Worm   128 AILFRALGDYEEFFKTSDSCLIYDGQSILFSNVDLFQGFREGAVKTKYMQLDGGEMDHKDLKSLP 192

  Fly   487 ---------QNPEVTVTDRNGRTLRYTIEIKETGDSTIDLKSLTTYMNDRIFDKPMRAMQCVEVV 542
                     :||.|..|       |..:..:.| ||.:|..||.             ..|.:|:.
 Worm   193 CIKLEVFPTKNPAVKFT-------REAVARRAT-DSNLDSVSLA-------------YQQILELA 236

  Fly   543 LASPCHNKAIRV-----GRSFFKMSDPNNRH-------ELDDGYEALVGLYQA--FMLG------ 587
            |..||.....|.     |:.||  .||....       ::.||.:.:.||.:.  |:.|      
 Worm   237 LTQPCLRNTARYVVFDHGKMFF--IDPLGEGFEKCDVVDVGDGKQVVPGLKKTINFIEGPYGRGR 299

  Fly   588 DRPFLNVDISHKSFPISMPMIEYLERFSLKAKINNTTNLDYSRRFLEPFLRGINVVYTPPQSFQS 652
            ..|.:.:|....:|..:.|:::.|:..:.:...:....|:..|  ....::|::...|    :..
 Worm   300 SNPSVVIDGMKVAFHKNQPILDKLKEITTQPVEHGLKGLEKDR--CAAVIKGLDCYST----YGG 358

  Fly   653 APRVYRVNGLSRAPASSETFE-HDGKKVTIASYFHS-RNYPLKFPQLHCL------NVGSSIKSI 709
            ..|.:::.|:....|.:..|| :||...|:|.||.. .|..|::|..:.:      |:.      
 Worm   359 RERHHKIEGIHHEGARNARFELNDGGSCTVAQYFEDVYNITLRYPDTNLIVSKERGNIN------ 417

  Fly   710 LLPIELCSIEEGQALNRKD-GATQVANMIKYAATSTNVRKRKIM---NLLQYFQHNLDPTISRFG 770
            ..|:||..|...|.:.... .:.|.....|.:|...:||:|.|:   |..|....|  ..:.:.|
 Worm   418 FYPMELLKISSHQRVQIPQLTSAQSQKTTKESAVLPDVRQRLILTGKNAAQISSDN--EVLGKMG 480

  Fly   771 IRIANDFIVVSTRVLSPPQVEYHSKRF----TMVKNGSWRMDGMKFLEPKPKAHKCAVLYCDPRS 831
            :.:..|.::|..|  |.|.|:..:...    ..||:..||.:  :|..|....:..| :|....:
 Worm   481 VSVCEDPLMVKGR--SIPAVKLANAEIGANPINVKDNKWRAN--RFTRPATAPNVWA-MYVVGTA 540

  Fly   832 GRKMNYTQLNDFGN--LIISQGKAVNISLDSDVT-----------YRP----------FTDDERS 873
            ..::....|..|.:  ..:.:.|.||:...:|::           |..          .|||  |
 Worm   541 STRITLDTLKKFADEFAAMCKSKGVNMPAPADISLIHMDAIESRLYDATKANCTFVFIITDD--S 603

  Fly   874 LDTIFADLKRSQHDLAIVIIPQFRISYDTIKQKAELQHGILTQCIKQFTVERKCNNQTIGNILLK 938
            :.|:....|..:.|..:::            |..:|.        |..:|.......|:.|::.|
 Worm   604 ITTLHQRYKMIEKDTKMIV------------QDMKLS--------KALSVINAGKRLTLENVINK 648

  Fly   939 INSKLNGINHKIKDDPRLPMMKNTMYIGADVTHPSPDQREI--------PSVVGVAASHDPYGAS 995
            .|.||.|.|:...|..:  .:.:.:.||..::.|....:..        |:|:|.|     |.|.
 Worm   649 TNVKLGGSNYVFVDAKK--QLDSHLIIGVGISAPPAGTKYAMENKGVLNPNVIGYA-----YNAQ 706

  Fly   996 YNMQY-------RLQRGALEEIEDMFSITLEHLRVYKEYRN-AYPDHIIYYRDGVSDGQFPKIKN 1052
            :|.::       ...:..|..|||   |.:..|..|:::.: ..|..:|.||.|.|:|....|..
 Worm   707 HNQEFSGDFVLNSASQDTLAPIED---IVMHSLNEYQKFHDGGLPRRVIVYRTGTSEGNHGSIMA 768

  Fly  1053 EELRCIKQACDKVGCKPKICCVIVVKRHHTRFF----------PSGDVTTSNKFN---------- 1097
            .|:...:.|........::..::|.|.|..|||          |....:|:::.:          
 Worm   769 YEIPLARAAMRDFSPDIQLVYIVVSKDHSFRFFKPDLASLASRPQATSSTASRHSAMPAAPKAWD 833

  Fly  1098 -NVDPGTVVDRTIVHPNEMQFFMVSHQAIQGTAKPTRYNVIENTGNLDIDLLQQLTYNLCHMFPR 1161
             |:.||.:||..:.:|...|||:.||..:|||||...|.|:.:...:.:..|:.:||.|||:...
 Worm   834 LNIAPGILVDSIVTNPACKQFFLNSHITLQGTAKTPLYTVLADDAKVSMTALEDITYKLCHLHQI 898

  Fly  1162 CNRSVSYPAPAYLAHLVAARGR 1183
            .....|.|.|.|:|:..|.|||
 Worm   899 VGLPTSLPTPLYVANEYAKRGR 920

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AGO2NP_730054.1 PLN03202 411..1180 CDD:215631 198/931 (21%)
ArgoN 411..543 CDD:293095 37/198 (19%)
ArgoL1 554..601 CDD:285861 13/67 (19%)
PAZ 605..719 CDD:239207 25/122 (20%)
Piwi_ago-like 764..1186 CDD:240015 110/485 (23%)
wago-4NP_496751.1 PLN03202 67..897 CDD:215631 190/905 (21%)
PAZ_argonaute_like 316..426 CDD:239212 24/122 (20%)
Piwi 594..924 CDD:280353 88/360 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1041
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR22891
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.960

Return to query results.
Submit another query.