DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AGO2 and ppw-1

Sequence 1:NP_730054.1 Gene:AGO2 FlyBaseID:FBgn0087035 Length:1217 Species:Drosophila melanogaster
Sequence 2:NP_491323.2 Gene:ppw-1 WormBaseID:WBGene00004093 Length:887 Species:Caenorhabditis elegans

Alignment Length:925 Identity:220/926 (24%)
Similarity:370/926 (40%) Gaps:190/926 (21%)


  Fly   377 QTQSQGQYQSRGP--PQQQQAAPLPLPPQPAGSIKRGT-----------IGKPGQ------VGIN 422
            :.|.:..:.|..|  |..|:....||..:...:::|||           ..||.|      |.:|
 Worm     2 EKQLEAMFVSDRPAAPAAQKLGTAPLAAKKTRNVERGTKVNIDTNIRKLTIKPNQPIYKYAVQVN 66

  Fly   423 YL---------DLDLSKMPSVAYHYDVKIMPERPKKFYRQAFEQFRVDQLGGAVLAYDGKASCYS 478
            |:         .:::||.......:|..  ..|.:|.|.:|.:::...:.||... ||.:||.|:
 Worm    67 YVFRKPDGTEATIEMSKSAKKGTEHDND--KTRCQKVYNEAIKRYDELKTGGPFF-YDRQASLYT 128

  Fly   479 VDKLPLNSQNPEVTVTDR-----NGRTLRYTI-EIKETGDSTIDLKSLTTYMNDRIFDKPMRAMQ 537
            :.|  |.:::....|||:     |.:..::.: ::.::..||.:....||.......||.:  ::
 Worm   129 LTK--LKNESISFVVTDKICKRQNFKEAQFVLKKVDQSFQSTSNDVIRTTNSCPANADKTL--LE 189

  Fly   538 CVEVVLASPC-HNK-AIRVGRSFFKMSDPNNRHELDDGYE--ALVGLYQAFMLG----------- 587
            .:.::::.|. .|| .|.||.....:.||.   .:|..|:  |...||..  :|           
 Worm   190 AMNIIVSGPAFENKNVITVGACVHYLIDPT---VVDVAYKEYAEGQLYSG--VGASKSVKTLEGT 249

  Fly   588 DRP----FLNVDISHKSF-PISMPMIEYLERF-----SLKAKINNTTNLDYSRRFLEPFLRGINV 642
            |:.    |:..::....| |...|::|.|:.|     :|||      |...::|..:.|: |::|
 Worm   250 DKKVPSLFMTTEMKTTLFHPDYAPLVELLQTFRGFSTTLKA------NSPAAQRIEKAFV-GLDV 307

  Fly   643 VYTPPQSFQSAPRVYRVN-GLS-----------RAPASSETFEHDGKK---VTIASYFHSR-NYP 691
            |..           |.|: ||.           ...|....||.:...   ..:..||..: ...
 Worm   308 VLN-----------YGVHKGLGEDGVVMKIRRFHTSAKETCFEVEKSTREFTNVFDYFKKKYGIT 361

  Fly   692 LKFPQLHCLNVGSSIKSILLPIE---LC---SIEEGQALNRKDGATQVANMIKYAATSTNVRKR- 749
            ||:|.|..:........|..|.|   ||   ::...|.:|.:.     |:|||.:|...::||. 
 Worm   362 LKYPDLFTIEAKGKQGKIHFPAEVLLLCPNQTVTNDQMINNEQ-----ADMIKMSAAQPHIRKTT 421

  Fly   750 --KIMNLLQYFQHNLDPTISRFGIRIANDFIVVSTRVLSPPQVEYHSKRFTMVKNGSWRMDGMKF 812
              .|:..:....:|:      :|.....|.:.:...||..|::.:...:...:.|...|.     
 Worm   422 TDTIVRNVGLASNNI------YGFIKVEDPVNLEGMVLPKPKIAFAGNQLADLANPKSRF----- 475

  Fly   813 LEPKPKAHKCAVLYCDPRSGRK--MNYTQLNDFGNL-------IISQG-KAVNISLDSDVTYRPF 867
                |.....|..|.|.:...|  :.:.|..:...|       :::.| |..|.::...:     
 Worm   476 ----PTDFNRAGQYYDAKELTKWELVFVQNEEVQGLAKQLADEMVNNGMKCSNPTMSFII----- 531

  Fly   868 TDDERSLDTIFADLKRSQHDLAIVIIPQFRISYDTIKQKAELQHGILTQCIKQFTVERKCNN-QT 931
               ...|:.||...|.:...|...:: :.|.:|....:..|.::.:|||.|:..|.|:.... ||
 Worm   532 ---RGDLEPIFKKAKAAGTQLLFFVV-KSRYNYHQQIKALEQKYDVLTQEIRAETAEKVFRQPQT 592

  Fly   932 IGNILLKINSKLNGINHKIKDDP-RLPMMKNTMYIGADVTHPSPDQREIPSVVGVAAS----HDP 991
            ..||:.|.|.||.|:|:.|..:. ..|   |.:.:|...:.......:.|..||.||:    |..
 Worm   593 RLNIINKTNMKLGGLNYAIGSEAFNKP---NRLIVGFVTSQRVGGNPDYPISVGFAANMLKHHQK 654

  Fly   992 YGASYNMQYRLQRGALEEIEDMFSITLEH--LRVYK---EYRNAYPDHIIYYRDGVSDGQFPKIK 1051
            :...|...:|        ..|:|...::.  |.::|   |.|.. ||.|:.|.:|||:|||..|.
 Worm   655 FAGGYVYVHR--------DRDVFGSIIKDTLLAIFKTCTEQRGR-PDDILLYFNGVSEGQFSMIN 710

  Fly  1052 NEELRCIKQAC---DKVGC---KPKICCVIVVKRHHTRFFPSGDVTTSNKFNNVDPGTVVDRTIV 1110
            .|....:|:||   .|.|.   :|.|..:...|.|:.|.:.|    ...:..|::||||||.|||
 Worm   711 EEFSARVKEACMAFQKEGTPPFRPHITIIASSKAHNERLYKS----DKGRIVNLEPGTVVDHTIV 771

  Fly  1111 HPNEMQFFMVSHQAIQGTAKPTRYNVIENT--GNLDIDL--LQQLTYNLCHMFPRCNRSVSYPAP 1171
            .....:::..|..|.|||||.|::.:|..|  |.....|  |:|||.:||:........|..|.|
 Worm   772 SNVYTEWYHASAVARQGTAKATKFTLIFTTKAGPQAEPLWHLEQLTNDLCYDHQIVFHPVGLPVP 836

  Fly  1172 AYLAHLVAARGRVYL 1186
            .|:|...:.||.:.|
 Worm   837 LYIADRYSQRGAMVL 851

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AGO2NP_730054.1 PLN03202 411..1180 CDD:215631 209/882 (24%)
ArgoN 411..543 CDD:293095 34/164 (21%)
ArgoL1 554..601 CDD:285861 12/64 (19%)
PAZ 605..719 CDD:239207 31/141 (22%)
Piwi_ago-like 764..1186 CDD:240015 117/453 (26%)
ppw-1NP_491323.2 PAZ_argonaute_like 272..389 CDD:239212 30/135 (22%)
Piwi-like 444..849 CDD:239208 116/439 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1041
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR22891
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.