DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AGO2 and sago-2

Sequence 1:NP_730054.1 Gene:AGO2 FlyBaseID:FBgn0087035 Length:1217 Species:Drosophila melanogaster
Sequence 2:NP_490758.1 Gene:sago-2 WormBaseID:WBGene00018921 Length:887 Species:Caenorhabditis elegans

Alignment Length:880 Identity:211/881 (24%)
Similarity:357/881 (41%) Gaps:174/881 (20%)


  Fly   407 SIKRGTIGKPGQ------VGINYL---------DLDLSKMPSVAYHYDVKIMPERPKKFYRQAFE 456
            :|::.|| ||.|      |.:||:         .:::||.......:|..  ..|.:..|.:|.:
 Worm    46 NIRKLTI-KPNQPIYKYAVQVNYVFRKPDGTEATIEMSKSAKKGTEHDND--KTRCQNVYNEAIK 107

  Fly   457 QFRVDQLGGAVLAYDGKASCYSVDKLPLNSQNPEVTVTDR-----NGRTLRYTI-EIKETGDSTI 515
            ::...:.||... ||.:||.|::.|  |.:::....|||:     |.:..::.: ::.::..||.
 Worm   108 RYDELKTGGPFF-YDRQASLYTLTK--LKNESISFVVTDKICKRQNFKEAQFVLKKVDQSFQSTS 169

  Fly   516 DLKSLTTYMNDRIFDKPMRAMQCVEVVLASPC-HNK-AIRVGRSFFKMSDPNNRHELDDGYEAL- 577
            :....||.......||.:  ::.:.::::.|. .|| .|.||.....:.||..   :|..|:.. 
 Worm   170 NDVIKTTNSCPANADKTL--LEAMNIIVSGPAFENKNVITVGACVHYLIDPTG---VDVAYKEYP 229

  Fly   578 -------VGLYQAFML---GDRP----FLNVDISHKSF-PISMPMIEYLERF-----SLKAKINN 622
                   ||:.::...   .|:.    |:..::....| |...|::|.|:.|     :|||    
 Worm   230 EGQLYSGVGVSKSVKTLEGTDKKVPSLFMTTEMKTTLFHPDYAPLVELLQTFRGFSTTLKA---- 290

  Fly   623 TTNLDYSRRFLEPFLRGINVVYTPPQSFQSAPRVYRVN-GLS-----------RAPASSETFEHD 675
              |...::|..:.|: |::||..           |.|: ||.           ...|....||.:
 Worm   291 --NSPAAQRIEKAFV-GLDVVLN-----------YGVHKGLGEDGVVMKIRRFHTSAKETCFEVE 341

  Fly   676 GKK---VTIASYFHSR-NYPLKFPQLHCLNVGSSIKSILLPIE---LC---SIEEGQALNRKDGA 730
            ...   ..:..||..: ...||:|.|..:........|..|.|   ||   ::...|.:|.:.  
 Worm   342 KSTREFTNVFDYFKKKYGITLKYPDLFTIEAKGKQGKIHFPAEVLLLCPNQTVTNDQMINNEQ-- 404

  Fly   731 TQVANMIKYAATSTNVRKR---KIMNLLQYFQHNLDPTISRFGIRIANDFIVVSTRVLSPPQVEY 792
               |:|||.:|...::||.   .|:..:....:|:      :|.....|.:.:...||..|::.:
 Worm   405 ---ADMIKMSAAQPHIRKTTTDTIVRNVGLASNNI------YGFIKVEDPVNLEGMVLPKPKIAF 460

  Fly   793 HSKRFTMVKNGSWRMDGMKFLEPKPKAHKCAVLYCDPRSGRK--MNYTQLNDFGNL-------II 848
            ...|...:.|...|.         |.....|..|.|.:...|  :.:.|..:...|       ::
 Worm   461 AGNRLADLANPKSRF---------PTDFNRAGQYYDAKELTKWELVFVQNEEVQGLAKQLADEMV 516

  Fly   849 SQG-KAVNISLDSDVTYRPFTDDERSLDTIFADLKRSQHDLAIVIIPQFRISYDTIKQKAELQHG 912
            :.| |..|.::...:        ...|:.||...|.:...|...:: :.|.:|....:..|.::.
 Worm   517 NNGMKCSNPTMSFII--------RGDLEPIFKKAKAAGTQLLFFVV-KSRYNYHQQIKALEQKYD 572

  Fly   913 ILTQCIKQFTVERKCNN-QTIGNILLKINSKLNGINHKIKDDP-RLPMMKNTMYIGADVTHPSPD 975
            :|||.|:..|.|:.... ||..||:.|.|.||.|:|:.|..:. ..|   |.:.:|...:.....
 Worm   573 VLTQEIRAETAEKVFRQPQTRLNIINKTNMKLGGLNYAIGSEAFNKP---NRLIVGFVTSQRVGG 634

  Fly   976 QREIPSVVGVAAS----HDPYGASYNMQYRLQRGALEEIEDMFSITLEH--LRVYK---EYRNAY 1031
            ..:.|..||.||:    |..:...|...:|        ..|:|...::.  |.::|   |.|.. 
 Worm   635 NPDYPISVGFAANMLKHHQKFAGGYVYVHR--------DRDVFGSIIKDTLLTIFKTCTEQRGR- 690

  Fly  1032 PDHIIYYRDGVSDGQFPKIKNEELRCIKQAC---DKVGC---KPKICCVIVVKRHHTRFFPSGDV 1090
            ||.|:.|.:|||:|||..|..|....:|:||   .|.|.   :|.|..:...|.|:.|.:.|   
 Worm   691 PDDILLYFNGVSEGQFSMINEEFSARVKEACMAFQKEGTPPFRPHITIIASSKAHNERLYKS--- 752

  Fly  1091 TTSNKFNNVDPGTVVDRTIVHPNEMQFFMVSHQAIQGTAKPTRYNVIENT--GNLDIDL--LQQL 1151
             ...:..|::||||||.|||.....:::..|..|.|||||.|::.:|..|  |.....|  |:||
 Worm   753 -DKGRIVNLEPGTVVDHTIVSNVYTEWYHASAVARQGTAKATKFTLIFTTKAGPQAEPLWHLEQL 816

  Fly  1152 TYNLCHMFPRCNRSVSYPAPAYLAHLVAARGRVYL 1186
            |.:||:........|..|.|.|:|...:.||.:.|
 Worm   817 TNDLCYDHQIVFHPVGLPVPLYIADRYSQRGAMVL 851

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AGO2NP_730054.1 PLN03202 411..1180 CDD:215631 207/869 (24%)
ArgoN 411..543 CDD:293095 33/153 (22%)
ArgoL1 554..601 CDD:285861 10/62 (16%)
PAZ 605..719 CDD:239207 31/141 (22%)
Piwi_ago-like 764..1186 CDD:240015 118/453 (26%)
sago-2NP_490758.1 PAZ_argonaute_like 272..389 CDD:239212 30/135 (22%)
Piwi-like 444..849 CDD:239208 117/439 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1041
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR22891
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.