DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7275 and AT4G28450

Sequence 1:NP_648767.1 Gene:CG7275 FlyBaseID:FBgn0036500 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_567810.5 Gene:AT4G28450 AraportID:AT4G28450 Length:452 Species:Arabidopsis thaliana

Alignment Length:451 Identity:192/452 (42%)
Similarity:283/452 (63%) Gaps:8/452 (2%)


  Fly     1 MKVKMISRNPDNYVRETKLQQHKMPRNYDPSLHPLEGPREYVRALNATKLDRVFAKPFVCNLSGH 65
            ||:|.:||:.|.|.||......::..|:||||.|:|...||.|||.|.||:::||:|||..:.||
plant     1 MKIKTLSRSVDEYTRERSQDLQRVFHNFDPSLRPMEKAVEYQRALTAAKLEKIFARPFVGAMDGH 65

  Fly    66 RDGVSCFGKHPKQLSTLATGAYDGEVRIWDLANRISSRNFVAHDGFVRGIAYTQNGGRIFTVGDD 130
            ||||||..|:|..|..:.:.:.||::|:||:::|.:...|..|.|.|||:..:.:|..:.:.|.|
plant    66 RDGVSCMAKNPNYLKGIFSASMDGDIRLWDISSRRTVCQFPGHQGAVRGLTASTDGNVLVSCGTD 130

  Fly   131 KTIKVWKAEAPEVGEDEV-------PVNTILSKFGLHGISHNRRDNKFATCGEVCAIWDERHNDP 188
            .|:::|....|.:.:..:       |..|.:.|.....:.|....:.|||.|....||:...:.|
plant   131 CTVRLWNVPRPSLEDSSISSENFIEPSATYVWKNAFWAVDHQFEGDLFATAGAQLDIWNHNRSQP 195

  Fly   189 LKTLKWGVDTLHTISYNPVETSILACCASDRSIILYDQREAQPLRKVVLTMKSNKLAWNPMEAFN 253
            :::.:||.|::.::.:||.|.::||..||||||.:||.|.:...||:::..|:|.:||||||..|
plant   196 VQSFQWGTDSVISVRFNPGEPNLLATSASDRSITIYDLRLSSAARKIIMMTKTNSIAWNPMEPMN 260

  Fly   254 FTVANEDCNLYTFDTRKLQTPLKVHFDHVSAVTDVDYSPTGKEFVSASYDKTIRIYNAHHSHSRD 318
            .|.||||.:.|:||.|||.....||.||||||.|:|:||||:|||:.|||:::||:..:..|||:
plant   261 LTAANEDGSCYSFDGRKLDEAKCVHKDHVSAVMDIDFSPTGREFVTGSYDRSVRIFPYNGGHSRE 325

  Fly   319 IYHTKRMQHVVCVAWSLDNRYVFSGSDEMNVRMWKANASEKLGVIRPRERVNFNYQEALKQKYAA 383
            ||||||||.|.||.:|.|..||.||||:.|:|:|||.|||:||||.|||:....|.||:|.:|..
plant   326 IYHTKRMQRVFCVKYSCDATYVISGSDDTNLRLWKAKASEQLGVILPREQKKHEYNEAVKNRYKH 390

  Fly   384 HPQIKRIARHRQVPRHVLNAQKKMRTVKEKEQVKEANVRKHTKKSKKVPYVSEKKKHVLKE 444
            ..::|||.|||.:|:.:..|...:|||.:.::.|||..:.|:.....|.....|:| ::||
plant   391 LSEVKRIVRHRHLPKPIYKAMGIIRTVNDSKRRKEARRKAHSAPGTVVTAPLRKRK-IIKE 450

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7275NP_648767.1 WD40 1..370 CDD:225201 167/376 (44%)
WD40 62..353 CDD:295369 126/298 (42%)
WD40 repeat 113..154 CDD:293791 10/48 (21%)
WD40 repeat 159..193 CDD:293791 8/34 (24%)
WD40 repeat 200..236 CDD:293791 16/36 (44%)
WD40 repeat 242..277 CDD:293791 19/35 (54%)
WD40 repeat 285..327 CDD:293791 26/42 (62%)
WD40 repeat 328..352 CDD:293791 13/24 (54%)
Sof1 354..439 CDD:282068 33/85 (39%)
AT4G28450NP_567810.5 WD40 <63..362 CDD:225201 128/299 (43%)
WD40 63..360 CDD:238121 126/297 (42%)
WD40 repeat 69..107 CDD:293791 13/38 (34%)
WD40 repeat 113..161 CDD:293791 10/48 (21%)
WD40 repeat 166..200 CDD:293791 8/34 (24%)
WD40 repeat 207..243 CDD:293791 16/36 (44%)
WD40 repeat 249..286 CDD:293791 21/37 (57%)
WD40 repeat 292..334 CDD:293791 26/42 (62%)
WD40 repeat 335..359 CDD:293791 13/24 (54%)
Sof1 361..445 CDD:282068 33/84 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H6430
Inparanoid 1 1.050 395 1.000 Inparanoid score I473
OMA 1 1.010
OrthoDB 1 1.010 D418107at2759
OrthoInspector 1 1.000 T193630
orthoMCL 1 0.900 OOG5_127890
Panther 1 1.100 LDO PTHR22851
Phylome 1 0.910 0.667 Consistency score
98.980

Return to query results.
Submit another query.