DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7275 and Dcaf13

Sequence 1:NP_648767.1 Gene:CG7275 FlyBaseID:FBgn0036500 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_941008.2 Gene:Dcaf13 MGIID:2684929 Length:445 Species:Mus musculus

Alignment Length:442 Identity:262/443 (59%)
Similarity:335/443 (76%) Gaps:1/443 (0%)


  Fly     1 MKVKMISRNPDNYVRETKLQQHKMPRNYDPSLHPLEGPREYVRALNATKLDRVFAKPFVCNLSGH 65
            |||||:|||||||||||||...::||||||:|||.|.|||||||||||||:|||||||:.:|.||
Mouse     1 MKVKMLSRNPDNYVRETKLDIQRVPRNYDPTLHPFEVPREYVRALNATKLERVFAKPFLASLDGH 65

  Fly    66 RDGVSCFGKHPKQLSTLATGAYDGEVRIWDLANRISSRNFVAHDGFVRGIAYTQNGGRIFTVGDD 130
            ||||:|..||||.|:::.:||.||||:||:|..|...|...||:|||||:.....|...||||||
Mouse    66 RDGVNCLAKHPKSLASVLSGACDGEVKIWNLTKRKCIRTIQAHEGFVRGMCTRFCGTSFFTVGDD 130

  Fly   131 KTIKVWKAEAPEVGEDEVPVNTILSKFGLHGISHNRRDNKFATCGEVCAIWDERHNDPLKTLKWG 195
            ||:|.||.:.|..||:|.|:.|:|.|....||.|:.:|..|||||:...||||:...|:.::.||
Mouse   131 KTVKQWKMDGPGYGEEEEPLYTVLGKTVYTGIDHHWKDPVFATCGQQVDIWDEQRTSPVCSMNWG 195

  Fly   196 VDTLHTISYNPVETSILACCASDRSIILYDQREAQPLRKVVLTMKSNKLAWNPMEAFNFTVANED 260
            .|::.::.:|||||.:|..|||||:|:|||.|:|.||:||:|.|::|.:.||||||||||.||||
Mouse   196 FDSISSVKFNPVETFLLGSCASDRNIVLYDMRQATPLKKVILEMRTNTICWNPMEAFNFTAANED 260

  Fly   261 CNLYTFDTRKLQTPLKVHFDHVSAVTDVDYSPTGKEFVSASYDKTIRIYNAHHSHSRDIYHTKRM 325
            .||||||.|.|.||:.||.||||||.|||||||||||||||:||:|||:....|.||::||||||
Mouse   261 YNLYTFDMRALDTPVMVHMDHVSAVLDVDYSPTGKEFVSASFDKSIRIFPVDKSRSREVYHTKRM 325

  Fly   326 QHVVCVAWSLDNRYVFSGSDEMNVRMWKANASEKLGVIRPRERVNFNYQEALKQKYAAHPQIKRI 390
            |||:||.|:.|::|:..||||||:|:|||||||||||:..||:...:|.:.||:|:..||.:|||
Mouse   326 QHVMCVKWTSDSKYIMCGSDEMNIRLWKANASEKLGVLTSREKAANDYNQKLKEKFQYHPHVKRI 390

  Fly   391 ARHRQVPRHVLNAQKKMRTVKEKEQVKEANVRKHTKKSKKVPYVSEKKKHVL 442
            ||||.:|:.:.:..::.|.:||..:.||.|.|||:|.. .||.|||:||||:
Mouse   391 ARHRHLPKSIYSQIQEQRVMKEARRRKEMNRRKHSKPG-SVPIVSERKKHVV 441

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7275NP_648767.1 WD40 1..370 CDD:225201 229/369 (62%)
WD40 62..353 CDD:295369 169/291 (58%)
WD40 repeat 113..154 CDD:293791 20/41 (49%)
WD40 repeat 159..193 CDD:293791 14/34 (41%)
WD40 repeat 200..236 CDD:293791 21/36 (58%)
WD40 repeat 242..277 CDD:293791 25/35 (71%)
WD40 repeat 285..327 CDD:293791 31/42 (74%)
WD40 repeat 328..352 CDD:293791 13/24 (54%)
Sof1 354..439 CDD:282068 41/85 (48%)
Dcaf13NP_941008.2 WD40 1..>360 CDD:225201 224/359 (62%)
WD40 59..353 CDD:238121 169/294 (57%)
WD 1 64..104 23/40 (58%)
WD40 repeat 70..107 CDD:293791 17/37 (46%)
WD 2 107..146 22/39 (56%)
WD40 repeat 112..154 CDD:293791 21/42 (50%)
WD 3 149..191 18/42 (43%)
WD40 repeat 162..195 CDD:293791 14/33 (42%)
WD 4 194..234 22/40 (55%)
WD40 repeat 199..267 CDD:293791 43/68 (63%)
WD 5 236..276 27/40 (68%)
WD 6 280..319 29/39 (74%)
WD40 repeat 285..327 CDD:293791 31/42 (74%)
WD 7 323..362 28/39 (72%)
WD40 repeat 328..352 CDD:293791 13/24 (54%)
Sof1 354..438 CDD:282068 41/85 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C267986521
eggNOG 1 0.900 E1_KOG0268
Hieranoid 1 1.000
Homologene 1 1.000 H6430
Inparanoid 1 1.050 562 1.000 Inparanoid score I1074
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004083
OrthoInspector 1 1.000 T1085018
orthoMCL 1 0.900 OOG5_127890
Panther 1 1.100 LDO PTHR22851
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R295
TreeFam 1 0.960
1312.790

Return to query results.
Submit another query.