DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ran-like and GSP1

DIOPT Version :8

Sequence 1:NP_524082.1 Gene:Ran-like / 39666 FlyBaseID:FBgn0036497 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_013396.1 Gene:GSP1 / 851000 SGDID:S000004284 Length:219 Species:Saccharomyces cerevisiae

Alignment Length:207 Identity:123/208 (59%)
Similarity:154/208 (74%) Gaps:0/208 (0%)


  Fly    11 FKLILIGDGGTGKTTLVKRHLTGEFKMQYNATLGVEVEQLLFNTNRGVFRIDVWDTAGQERYGGL 75
            |||:|:|||||||||.|||||||||:.:|.||:||||..|.|.||.|..:.|||||||||::|||
Yeast    13 FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEIKFDVWDTAGQEKFGGL 77

  Fly    76 RDGYFVQSQCAIIMFDVASSNTYNNVKRWHRDLVRVCGNIPIVICGNKVDIMHKKTWKKGVDFDR 140
            ||||::.:|||||||||.|..||.||..|||||||||.|||||:||||||:..:|...|.:.|.|
Yeast    78 RDGYYINAQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLCGNKVDVKERKVKAKTITFHR 142

  Fly   141 KTNIYLIEMSAKSNYNVEKPFVYLLRKLVGDPSLQLVQSPAIQPPKVVFTDEMSRQVESLFNEAK 205
            |.|:...::|||||||.||||::|.|||.|:|.|:.|.|||:.||:|...:::.:|.:....:|.
Yeast   143 KKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLEFVASPALAPPEVQVDEQLMQQYQQEMEQAT 207

  Fly   206 SKPLPTIYDIDL 217
            :.|||...|.||
Yeast   208 ALPLPDEDDADL 219

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ran-likeNP_524082.1 PTZ00132 1..210 CDD:240284 119/199 (60%)
Ran 11..176 CDD:206643 108/165 (65%)
GSP1NP_013396.1 PTZ00132 4..216 CDD:240284 120/203 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C284355441
eggNOG 1 0.900 E1_KOG0096
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S18
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24071
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
65.750

Return to query results.
Submit another query.