DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ran-like and RAN3

DIOPT Version :8

Sequence 1:NP_524082.1 Gene:Ran-like / 39666 FlyBaseID:FBgn0036497 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_200330.1 Gene:RAN3 / 835612 AraportID:AT5G55190 Length:221 Species:Arabidopsis thaliana

Alignment Length:200 Identity:119/200 (60%)
Similarity:145/200 (73%) Gaps:0/200 (0%)


  Fly    11 FKLILIGDGGTGKTTLVKRHLTGEFKMQYNATLGVEVEQLLFNTNRGVFRIDVWDTAGQERYGGL 75
            |||:::|||||||||.|||||||||:.:|..|:||||..|.|.||.|..|...|||||||::|||
plant    14 FKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGL 78

  Fly    76 RDGYFVQSQCAIIMFDVASSNTYNNVKRWHRDLVRVCGNIPIVICGNKVDIMHKKTWKKGVDFDR 140
            ||||::..|||||||||.:..||.||..|||||.|||.|||||:||||||:.:::...|.|.|.|
plant    79 RDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHR 143

  Fly   141 KTNIYLIEMSAKSNYNVEKPFVYLLRKLVGDPSLQLVQSPAIQPPKVVFTDEMSRQVESLFNEAK 205
            |.|:...|:|||||||.||||:||.|||.||.:|..|:|||:.||:|.......:|.|:....|.
plant   144 KKNLQYYEISAKSNYNFEKPFLYLARKLAGDANLHFVESPALAPPEVQIDLAAQQQHEAELAAAA 208

  Fly   206 SKPLP 210
            |:|||
plant   209 SQPLP 213

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ran-likeNP_524082.1 PTZ00132 1..210 CDD:240284 118/199 (59%)
Ran 11..176 CDD:206643 105/165 (64%)
RAN3NP_200330.1 PLN03071 1..218 CDD:178620 119/200 (60%)
Ran 14..179 CDD:206643 105/165 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1083175at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24071
Phylome 1 0.910 0.667 Consistency score
33.020

Return to query results.
Submit another query.