DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ran-like and Rasl2-9

DIOPT Version :8

Sequence 1:NP_524082.1 Gene:Ran-like / 39666 FlyBaseID:FBgn0036497 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_001160147.1 Gene:Rasl2-9 / 751812 RGDID:2314256 Length:216 Species:Rattus norvegicus

Alignment Length:210 Identity:124/211 (59%)
Similarity:156/211 (74%) Gaps:0/211 (0%)


  Fly     1 MQPQEEVKAIFKLILIGDGGTGKTTLVKRHLTGEFKMQYNATLGVEVEQLLFNTNRGVFRIDVWD 65
            |..|.:.:..|||:|:|||||||||.:||||||||:.:|.|||||||..|:|:||||..:.:|||
  Rat     1 MAGQGKPQIQFKLVLVGDGGTGKTTFMKRHLTGEFEKEYVATLGVEVHTLVFHTNRGPIKFNVWD 65

  Fly    66 TAGQERYGGLRDGYFVQSQCAIIMFDVASSNTYNNVKRWHRDLVRVCGNIPIVICGNKVDIMHKK 130
            |||||::|||||||::|:|||||||||.|..||.||..||:||||||.|||||:|||||||...|
  Rat    66 TAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPSWHKDLVRVCENIPIVLCGNKVDIKDMK 130

  Fly   131 TWKKGVDFDRKTNIYLIEMSAKSNYNVEKPFVYLLRKLVGDPSLQLVQSPAIQPPKVVFTDEMSR 195
            ...|.:.|.||.|:...::|||||||.||||.:|.|||:|||:|:.|..||:.||:||....::.
  Rat   131 VKAKPILFHRKKNLQYYDISAKSNYNFEKPFFWLARKLIGDPNLEFVAMPALAPPEVVMDPALAA 195

  Fly   196 QVESLFNEAKSKPLP 210
            |.|.....|::..||
  Rat   196 QYEHDLEVAQTTALP 210

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ran-likeNP_524082.1 PTZ00132 1..210 CDD:240284 123/209 (59%)
Ran 11..176 CDD:206643 110/165 (67%)
Rasl2-9NP_001160147.1 Ran 11..176 CDD:206643 110/165 (67%)
RAN 16..215 CDD:128473 118/196 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C284296162
eggNOG 1 0.900 E1_KOG0096
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1083175at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24071
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
54.900

Return to query results.
Submit another query.