DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ran-like and RGD1306195

DIOPT Version :8

Sequence 1:NP_524082.1 Gene:Ran-like / 39666 FlyBaseID:FBgn0036497 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_001014084.1 Gene:RGD1306195 / 313163 RGDID:1306195 Length:216 Species:Rattus norvegicus

Alignment Length:210 Identity:119/211 (56%)
Similarity:155/211 (73%) Gaps:0/211 (0%)


  Fly     1 MQPQEEVKAIFKLILIGDGGTGKTTLVKRHLTGEFKMQYNATLGVEVEQLLFNTNRGVFRIDVWD 65
            |..:.|....|||:|:|||||||||.|||||||||:.:|.|||||||..|:|:|:||..:.:|||
  Rat     1 MAAEGEPPVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLMFHTSRGPIKFNVWD 65

  Fly    66 TAGQERYGGLRDGYFVQSQCAIIMFDVASSNTYNNVKRWHRDLVRVCGNIPIVICGNKVDIMHKK 130
            |||||::|||||||::|:|.|||||||.|..||.||..|||||||||.|||||:||||||:..:|
  Rat    66 TAGQEKFGGLRDGYYIQAQGAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDVKDRK 130

  Fly   131 TWKKGVDFDRKTNIYLIEMSAKSNYNVEKPFVYLLRKLVGDPSLQLVQSPAIQPPKVVFTDEMSR 195
            ...|.:.|.||.|:...::|||||||.||||::|.|:|.||.:|:.|..||:.||:|:....:::
  Rat   131 VKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLSRRLTGDSNLEFVAMPALAPPEVIMDPALAK 195

  Fly   196 QVESLFNEAKSKPLP 210
            :.|.....|::..||
  Rat   196 KYERDLEVAQTTALP 210

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ran-likeNP_524082.1 PTZ00132 1..210 CDD:240284 118/209 (56%)
Ran 11..176 CDD:206643 107/165 (65%)
RGD1306195NP_001014084.1 PTZ00132 1..216 CDD:240284 119/211 (56%)
Ran 11..176 CDD:206643 107/165 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C284300781
eggNOG 1 0.900 E1_KOG0096
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1083175at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24071
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
54.900

Return to query results.
Submit another query.