DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ran-like and spi1

DIOPT Version :8

Sequence 1:NP_524082.1 Gene:Ran-like / 39666 FlyBaseID:FBgn0036497 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_596827.1 Gene:spi1 / 2540149 PomBaseID:SPBC1289.03c Length:216 Species:Schizosaccharomyces pombe

Alignment Length:216 Identity:128/217 (59%)
Similarity:155/217 (71%) Gaps:2/217 (1%)


  Fly     2 QPQEEVKAIFKLILIGDGGTGKTTLVKRHLTGEFKMQYNATLGVEVEQLLFNTNRGVFRIDVWDT 66
            |||.  ...|||:|:|||||||||.|||||||||:.:|.|||||||..|.|:||.|....:||||
pombe     3 QPQN--VPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATLGVEVHPLHFHTNFGEICFNVWDT 65

  Fly    67 AGQERYGGLRDGYFVQSQCAIIMFDVASSNTYNNVKRWHRDLVRVCGNIPIVICGNKVDIMHKKT 131
            ||||:.|||||||::|.||.||||||.|..||.||..|.|||||||.|||||:||||||:..:|.
pombe    66 AGQEKLGGLRDGYYIQGQCGIIMFDVTSRITYKNVPHWWRDLVRVCENIPIVLCGNKVDVKERKV 130

  Fly   132 WKKGVDFDRKTNIYLIEMSAKSNYNVEKPFVYLLRKLVGDPSLQLVQSPAIQPPKVVFTDEMSRQ 196
            ..|.:.|.||.|:...::|||||||.||||::|.|||||:|:|:.|.|||:.||:|....::..|
pombe   131 KAKAITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLVGNPNLEFVASPALAPPEVQVDQQLLAQ 195

  Fly   197 VESLFNEAKSKPLPTIYDIDL 217
            .:...|||.:.|||...|.||
pombe   196 YQQEMNEAAAMPLPDEDDADL 216

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ran-likeNP_524082.1 PTZ00132 1..210 CDD:240284 124/208 (60%)
Ran 11..176 CDD:206643 108/165 (65%)
spi1NP_596827.1 PTZ00132 1..213 CDD:240284 125/212 (59%)
Ran 10..175 CDD:206643 108/165 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24071
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.970

Return to query results.
Submit another query.