DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Best4 and Best2

DIOPT Version :8

Sequence 1:NP_001097609.1 Gene:Best4 / 39660 FlyBaseID:FBgn0036491 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_729159.2 Gene:Best2 / 38727 FlyBaseID:FBgn0035696 Length:809 Species:Drosophila melanogaster

Alignment Length:576 Identity:213/577 (37%)
Similarity:313/577 (54%) Gaps:76/577 (13%)


  Fly     1 MTVTYTSRVSTSSVLSNFLGLLVRWRGSIYKLIWLDLIVFFGLYCLLAITYRLLVNEEGKRFFEA 65
            |||:|...|...|....|..:|.:||||:|||||.:|:.:..||..:.:.||..:.|..:..|:.
  Fly     1 MTVSYAGEVPNGSSFGCFWKILWKWRGSVYKLIWRELVAYLCLYYTINVIYRFGLTESQQAIFKK 65

  Fly    66 IMSYCEKNGSLIPLSFVLGFFVRIVMNRWWDQYTTIPWPDGIAILISTSIHGS-----DDRARVM 125
            |..|..:....||:||||||:|.:|:.|||:||..:||||.:|:.||.:|..|     ::..|:|
  Fly    66 IRLYFGQQSESIPMSFVLGFYVNLVVKRWWEQYRLLPWPDTLALFISAAIPNSNGGVNNETGRLM 130

  Fly   126 RRTILRYVCLCQVIVFTMISPRVKRRFPTYTQIIEAGFLLENEKKIIEAMDQAFPSYPKHWMPIV 190
            ||.|:||:.|..||....||.||||||||...:::||.:.|:|.||.||::|..| ..|:|||:|
  Fly   131 RRNIMRYMVLAYVITLQRISLRVKRRFPTTQHLVDAGLMHESEMKIFEALNQKSP-MSKYWMPLV 194

  Fly   191 WAASIVMRARRENKIRDDYAVKTIIDELNQLRGNCGFLLYYDWISVPLVYTQVVTVATYSFFLFS 255
            ||.:|:.|||::..|..|:.|:||:.||:.:|...|.|:.||.:.||||||||||:..|::|:.:
  Fly   195 WATNIINRARKDGLIASDHIVQTILVELSDIRRRLGGLIGYDTVCVPLVYTQVVTLVLYTYFIAA 259

  Fly   256 VLGQQWNESHSDEDGTRIRR----WFPILTVLQFFFYMGWLKVAETLINPFGEDDDDFELNWIID 316
            :||:|...:..|..|   |.    :||:.|||||.||:|||||||.|||||||||||.||||:||
  Fly   260 LLGRQMLPNVLDRSG---REDPDLFFPLFTVLQFVFYVGWLKVAEVLINPFGEDDDDIELNWLID 321

  Fly   317 RNLTVSYCIVDEMHQEHPELVKDQYWEEVFPNEIPY--AQPKMRQNPPAASTAYMESQSKLQKR- 378
            |::..:|.||||||:|||||::|||||.|.|.::||  |....|::.|..|.    .:.|::|. 
  Fly   322 RHIKAAYMIVDEMHEEHPELLRDQYWECVVPKDLPYTVASEHYRKDEPKGSA----EKYKVKKED 382

  Fly   379 ----------------------HESAMSTLSTRSRNNFRQNFLGRPSATGSYSDSIQM------- 414
                                  :||..:.:..|.:||:....|.|..:..|.|.:...       
  Fly   383 AMYANIMPGGGKRMLSDDVYADYESVDTPMVERRKNNWLVRQLSRMGSMRSQSTAYSSGGMPFNR 447

  Fly   415 ----------EDGPSRVTFSENQFDLPHDEANSSHKPSQSTIDFNDLIEQRRRERRERIRHRFLD 469
                      |.|.......:.|....|.:..:..:||:|::....:..:..|.:|:.|:     
  Fly   448 NRLNSVYSSPESGLPLTILQQQQLQQAHQQQQAGSQPSKSSLYGKFVHRKSLRAQRQLIK----- 507

  Fly   470 MQSTHLRHDTSGAPYTITVLRP--PSDETLSE-----SQEAGDRAQQDPSGSKEPP 518
             |::.|    :|....:...||  |:.|...:     :..:...|.|..|.:..||
  Fly   508 -QNSKL----NGLNVNVAKTRPRIPTPEVAKDGNTNPATSSVLMAPQQLSTTSAPP 558

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Best4NP_001097609.1 Bestrophin 8..319 CDD:279411 151/320 (47%)
Best2NP_729159.2 Bestrophin 13..324 CDD:279411 150/315 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3547
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D145964at33208
OrthoFinder 1 1.000 FOG0000272
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10736
RoundUp 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.