DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Best4 and Best3

DIOPT Version :8

Sequence 1:NP_001097609.1 Gene:Best4 / 39660 FlyBaseID:FBgn0036491 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_001007584.1 Gene:Best3 / 382427 MGIID:3580298 Length:669 Species:Mus musculus

Alignment Length:575 Identity:211/576 (37%)
Similarity:312/576 (54%) Gaps:78/576 (14%)


  Fly     1 MTVTYTSRVSTSSVLSNFLGLLVRWRGSIYKLIWLDLIVFFGLYCLLAITYRLLVNEEGKRFFEA 65
            |||||:|:|:.::.. .|..||::||||||||::.:.|||..||..:::.||||:....||:||.
Mouse     1 MTVTYSSKVANATFF-GFHRLLLKWRGSIYKLLYREFIVFAVLYTAISLVYRLLLTGAQKRYFEK 64

  Fly    66 IMSYCEKNGSLIPLSFVLGFFVRIVMNRWWDQYTTIPWPDGIAILISTSIHGSDDRARVMRRTIL 130
            :..||::....||::|||||:|.:|:||||:|:..:||||.:.:|||:|:||||...|::|||::
Mouse    65 LSIYCDRYAEQIPVTFVLGFYVTLVVNRWWNQFVNLPWPDRLMLLISSSVHGSDQHGRLLRRTLM 129

  Fly   131 RYVCLCQVIVFTMISPRVKRRFPTYTQIIEAGFLLENEKKIIEAMDQAFPSYPKHWMPIVWAASI 195
            |||.|..:::|..:|..|.:||||...::||||:..:|:|:   .|.....:.|:|:|.:|..::
Mouse   130 RYVNLTSLLIFRSVSTAVYKRFPTMDHVVEAGFMTADERKL---FDHLKSPHLKYWVPFIWFGNL 191

  Fly   196 VMRARRENKIRDDYAVKTIIDELNQLRGNCGFLLYYDWISVPLVYTQVVTVATYSFFLFSVLGQQ 260
            ..:||.|.:|||...:::::.|:|:.|..|..|..|||:.:|||||||||:|.|:||...::|:|
Mouse   192 ATKARNEGRIRDSVDLQSLMTEMNRYRSWCSLLFGYDWVGIPLVYTQVVTLAVYTFFFACLIGRQ 256

  Fly   261 WNESHSDEDGTRIRRWFPILTVLQFFFYMGWLKVAETLINPFGEDDDDFELNWIIDRNLTVSYCI 325
            :.:......|..:..:.||.|:||||||.|||||||.|||||||||||||.||.|||||.||...
Mouse   257 FLDPTKGYVGHDLDLYVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNWCIDRNLQVSLLA 321

  Fly   326 VDEMHQEHPELVKDQYWEEVFPNEIPYAQPKMRQNPPA--ASTAYM------------------- 369
            |||||...|::.||.||::..... ||.........|:  .||..|                   
Mouse   322 VDEMHMSLPKMKKDIYWDDSAARP-PYTLAAADYCIPSFLGSTIQMGLSGSNFPAEDWLWNYEKH 385

  Fly   370 ESQSKLQKRHESAMSTL----STRSRNNFRQNFLGRPSATGSY----SDSIQMEDGPSRVTFSEN 426
            .::..:.:|.:..:||.    |.|.|.:|     ||.::..|.    |.:..:.|.|||      
Mouse   386 GNRHSVMRRVKRFLSTHEHPGSPRRRRSF-----GRQASDSSMFLPPSPARDLLDVPSR------ 439

  Fly   427 QFDLPHDEANSSHKPSQST-------IDFNDLIEQRRRERRERIRHRFLDMQSTHLRHDTSGAPY 484
               .|| ..:.:.|.|:|.       ....:|...|...|...::.  |..||: :|...:..|.
Mouse   440 ---NPH-RGSPTRKQSRSQEGSPKLHSSMGELSTIRETSRTSTLQS--LSPQSS-VRSSPTKMPQ 497

  Fly   485 T----ITVLRPPS--------DETLS-------ESQEAGDRAQQDPSGSKEPPPN 520
            .    ||....|:        |.|.|       ..|.:|...|.:|||:....||
Mouse   498 VPEVLITAAEAPAFSADSHQHDSTTSILSLEFTGVQPSGTEQQVEPSGTPPGDPN 552

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Best4NP_001097609.1 Bestrophin 8..319 CDD:279411 144/311 (46%)
Best3NP_001007584.1 Bestrophin 8..315 CDD:279411 144/311 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C63179688
eggNOG 1 0.900 E1_KOG3547
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 396 1.000 Inparanoid score I1942
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D145964at33208
OrthoFinder 1 1.000 FOG0000272
OrthoInspector 1 1.000 T130816
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10736
Phylome 1 0.910 0.889 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2974
TreeFam 1 0.960
1110.890

Return to query results.
Submit another query.