DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Best4 and BEST4

DIOPT Version :8

Sequence 1:NP_001097609.1 Gene:Best4 / 39660 FlyBaseID:FBgn0036491 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_695006.1 Gene:BEST4 / 266675 HGNCID:17106 Length:473 Species:Homo sapiens

Alignment Length:552 Identity:209/553 (38%)
Similarity:293/553 (53%) Gaps:127/553 (23%)


  Fly     1 MTVTYTSRVSTSSVLSNFLGLLVRWRGSIYKLIWLDLIVFFGLYCLLAITYRLLVNEEGKRFFEA 65
            |||:||.:|:.:. ...|.|||:|||||||||::.:.::|..||.:|:||||||:.:|.:..:..
Human     1 MTVSYTLKVAEAR-FGGFSGLLLRWRGSIYKLLYKEFLLFGALYAVLSITYRLLLTQEQRYVYAQ 64

  Fly    66 IMSYCEKNGSLIPLSFVLGFFVRIVMNRWWDQYTTIPWPDGIAILISTSIHGSDDRARVMRRTIL 130
            :..||.::..||||||||||:|.:|:||||.|||:||.||.:..:||.|:||.|.|.|::|||::
Human    65 VARYCNRSADLIPLSFVLGFYVTLVVNRWWSQYTSIPLPDQLMCVISASVHGVDQRGRLLRRTLI 129

  Fly   131 RYVCLCQVIVFTMISPRVKRRFPTYTQIIEAGFLLENEKKIIEAMDQAFPSYPKHWMPIVWAASI 195
            ||..|..|:|...:|.||.:||||...:::|||:.:.|:|..|::...|   .|:|:|.||..::
Human   130 RYANLASVLVLRSVSTRVLKRFPTMEHVVDAGFMSQEERKKFESLKSDF---NKYWVPCVWFTNL 191

  Fly   196 VMRARRENKIRDDYAVKTIIDELNQLRGNCGFLLYYDWISVPLVYTQVVTVATYSFFLFSVLGQQ 260
            ..:|||:.:||||.|:..:::|||:.|..|..|.:|||||:|||||||||:|.||||..|::|:|
Human   192 AAQARRDGRIRDDIALCLLLEELNKYRAKCSMLFHYDWISIPLVYTQVVTIAVYSFFALSLVGRQ 256

  Fly   261 WNESHS--------------------DEDGTRIRRWFPILTVLQFFFYMGWLKVAETLINPFGED 305
            :.|..:                    |.|     .:.|:.|:||||||.|||||||.:|||||||
Human   257 FVEPEAGAAKPQKLLKPGQEPAPALGDPD-----MYVPLTTLLQFFFYAGWLKVAEQIINPFGED 316

  Fly   306 DDDFELNWIIDRNLTVSYCIVDEMHQEHPELVKDQYWEEVFPNEIPYAQPKMRQNPPAASTAYME 370
            |||||.|.:|||||.||...||||:|..|...|||||:|        .||:    ||.......|
Human   317 DDDFETNQLIDRNLQVSLLSVDEMYQNLPPAEKDQYWDE--------DQPQ----PPYTVATAAE 369

  Fly   371 SQSKLQKRHESAMSTLSTRSRNNFRQNFLGRPSATGSYSDSIQMEDGPSRVTFSENQFDLPHDEA 435
            |.                            |||..|| :.:::|.|.|.:        .|..:.:
Human   370 SL----------------------------RPSFLGS-TFNLRMSDDPEQ--------SLQVEAS 397

  Fly   436 NSSHKPSQSTIDFNDLIEQRRRERRERIRHRFLDMQSTHLRHDTSGAPYTITVL----------R 490
            ..|.:|:.:.              :..:..|||.:          |||.....|          |
Human   398 PGSGRPAPAA--------------QTPLLGRFLGV----------GAPSPAISLRNFGRVRGTPR 438

  Fly   491 PP---------------SDETLSESQEAGDRA 507
            ||               :.....||.|:||.|
Human   439 PPHLLRFRAEEGGDPEAAARIEEESAESGDEA 470

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Best4NP_001097609.1 Bestrophin 8..319 CDD:279411 156/331 (47%)
BEST4NP_695006.1 Bestrophin 8..330 CDD:307280 156/331 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C63317130
eggNOG 1 0.900 E1_KOG3547
Hieranoid 1 1.000
Homologene 1 1.000 H129743
Inparanoid 1 1.050 396 1.000 Inparanoid score I1938
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D145964at33208
OrthoFinder 1 1.000 FOG0000272
OrthoInspector 1 1.000 T130037
orthoMCL 1 0.900 OOG5_149342
Panther 1 1.100 O PTHR10736
Phylome 1 0.910 0.889 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2974
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.